Si deseas distinguir tus productos, servicios o ambos de los de otra empresa, es posible que necesites una marca o nombre comercial. Descubre qué son, en qué consiste su procedimiento de registro y qué implica.
Información sobre los plazos de presentación de solicitudes de transformación de marcas de la Unión Europea en marca nacional española. Más información
Si tienes un nuevo dispositivo, producto o procedimiento que resuelva un problema técnico o tenga una ventaja práctica, existen distintas formas de protegerlo en España y en otros países. Descubre cómo hacerlo.
¿Tu innovación reside en la estética, la ornamentación o la apariencia de tu producto? Protégela mediante un diseño industrial. Descubre qué derechos confiere el registro y cómo realizar la tramitación.
Las patentes publicadas en todo el mundo son una valiosa fuente de información científica, técnica y comercial.
El Bono 3 (Patentes Nacionales, Patentes Europeas, Informes Tecnológicos de Patentes y Búsquedas Retrospectivas) está cerrado desde el pasado 19 de junio. Se informará más adelante sobre su reapertura.
Si eres emprendedor/a o una empresa y quieres potenciar y mejorar la rentabilidad de tu negocio protegiendo de forma adecuada los activos intangibles de tu organización, en este espacio encontrarás lo necesario.
76
resultados
Última actualización
03/07/2025 [06:45:00]
Resultados 25 a 50 de 76
Resumen de: US2025195498A1
The present invention relates to an inhibitor of the Helicobacter pylori (H. pylori) cell purine nucleotide salvage pathway (reserve pathway) for use in the treatment of H. pylori infection and/or the treatment or prevention of a disease associated with this infection, such as gastritis and duodenitis, gastric and duodenal ulcers, as well as gastric cancer and MALT-type lymphoma, as well as pancreatic cancer or neurodegenerative diseases or disorders. The present invention also provides a pharmaceutical composition comprising such an inhibitor of the H. pylori cell purine nucleotide salvage pathway and at least one pharmaceutically acceptable excipient. The present invention further provides a pharmaceutical composition comprising such an inhibitor of the H. pylori cell purine nucleotide salvage pathway, at least one pharmaceutically acceptable excipient and at least one additional drug for the treatment of H. pylori infection, selected in particular from an antibiotic, a proton pump inhibitor and a bismuth salt.
Resumen de: US2025195472A1
An indole alkaloid, specifically the alkaloid (3S,3aR,8aS)-3-butyl-5-hydroxy-3,3a,8a-trimethyl-3,3a,8,8a-tetrahydro-2H-furo2,3-bindole-2-one, with the generic name Andranone, as an antineoplastic agent against neoplastic cells of colon cancer, breast cancer, leukaemia, central nervous system cancer, prostate cancer, lung cancer and cervical cancer.
Resumen de: US2025197528A1
The present disclosure relates to multifunctional binding proteins comprising a first and a second antigen binding domains (ABDs) and all or part of an immunoglobulin Fc region or variant thereof, wherein the first ABD binds specifically to human BCMA and the second ABD binds specifically to human NKp46 and wherein all or part of the immunoglobulin Fc region or variant thereof bind to a human Fc-γ receptor.The disclosure also relates to methods for making said binding proteins, compositions thereof, and their uses, including the treatment or prevention of proliferative disorders, including multiple myeloma (MM).
Resumen de: EP4570321A2
The present disclosure relates to topical treatment of skin diseases, such as psoriasis, atopic dermatitis, alopecia, vitiligo, Reiter's syndrome, pityriasis rubra pilaris, epidermolysis bullosa simplex, palmoplantar keratoderma, pachyonychia congenita, steatocystoma multiplex, cutaneous lichen planus, cutaneous T-cell lymphoma, hidradenitis suppurativa, contact dermatitis, ichthyosis, and a disorder of keratinization, using (a) a JAK inhibitor, or a pharmaceutically acceptable salt thereof, and (b) vitamin D3, a vitamin D3 analog, or a pharmaceutically acceptable salt thereof.
Resumen de: WO2025120113A1
Provided herein are methods of treating and/or managing multiple myeloma, which comprise administering to a patient 3-(4-((4-(morpholinomethyl)benzyl)oxy)-1-oxoisoindolin-2-yl)piperidine-2,6-dione ("Compound A"), or an enantiomer or a mixture of enantiomers, a tautomer, an isotopolog, a pharmaceutically acceptable salt, solvate, hydrate, co-crystal, clathrate, or polymorph thereof, in combination with a bispecific antibody comprising a first binding part binding to B cell maturation antigen (BCMA) and a second binding part binding to cluster of differentiation 3 (CD3).
Resumen de: WO2025120219A2
The invention provides a CD16a-binding polypeptide, which comprises at least one motif that binds to CD16a, wherein said polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; the CD16a-binding polypeptide further comprising at least one additional functional portion, wherein the at least one functional portion comprises an additional binding moiety which is a binding partner recognising a protein in the B7 family and which is a polypeptide, peptide or small molecule. The invention also provides pharmaceutical compositions comprising the CD16a- binding polypeptide, and the use of the CD16a-binding polypeptide or pharmaceutical compositions as a medicament, particularly for use in the treatment or prophylaxis of cancer, such as multiple myeloma.
Resumen de: WO2025120218A1
The invention provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; wherein the CD16a-binding motif sequence is: QQIAQYEIRRLPNLNHHQTFAFIKSLL (SEQ ID NO: 1). The invention also provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; wherein the sequence of the CD16a-binding polypeptide is: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2). The invention also provides a CD16a-binding polypeptide which comprises the following structure: BCMA-binding polypeptide-Linker 1-BCMA-binding polypeptide-Linker 2-CD16a-binding polypeptide, wherein: each of the BCMA-binding polypeptides comprises the sequence: VDNKFNKENQFADEEIAALPNLNFYQKWAFIRKLMDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 4); the CD16a-binding polypeptide comprises the sequence: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2) or comprises the sequence: VDNKFNKEQQIAQYEIRKLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 3); and wherein each of Linker 1 an
Resumen de: AU2023373360A1
A method for assessing responsiveness of a subject to a treatment comprising T cells expressing a bivalent BCMA-targeting chimeric antigen receptor (CAR), comprising administering to the subject the T cells, and assessing the responsiveness of the subject to the treatment based on time length the subject maintains minimal residual disease (MRD) negative status.
Resumen de: WO2025122791A1
Provided herein are methods and uses for treating multiple myeloma (such as Newly Diagnosed Multiple Myeloma) in a patient in need thereof. The methods comprise administering to the patient an anti-CD38 antibody, bortezomib, lenalidomide, and dexamethasone.
Resumen de: AU2023373683A1
Methods of treating non-Hodgkin lymphoma by administering a multispecific antibody to a patient in need are provided. Methods of making such antibodies, and compositions, including pharmaceutical compositions, comprising such antibodies, are also provided.
Resumen de: WO2025122985A1
Provided herein are methods of treating acute myeloid leukemia (AML) in a subject in need thereof, comprising administering to the subject combinations of Compound 1, or a pharmaceutically acceptable salt thereof, venetoclax, and 5-azacitidine. Also provided herein are methods of inhibiting/overcoming resistance of AML to venetoclax in a subject in need thereof, and/or improving the efficacy of venetoclax in the treatment of AML in a subject in need thereof, comprising administering to the subject combinations of Compound 1, or a pharmaceutically acceptable salt thereof, venetoclax, and 5-azacitidine.
Resumen de: WO2025119248A1
A compound represented by formula (I) as a PCNA inhibitor, or a pharmaceutically acceptable salt thereof, or a deuterated compound thereof, a preparation method therefor, an intermediate compound thereof, a pharmaceutical composition thereof and the use thereof. The PCNA inhibitor and the pharmaceutical composition comprising same can be used for treating cancers, comprising lung cancer, melanoma, colon cancer, rectal cancer, prostate cancer, ovarian cancer, leukemia, etc with PCNA overexpression.
Resumen de: WO2025119153A1
Provided is a composition which can be a lyophilized preparation solution or a lyophilized powder preparation. The composition comprises a multispecific antibody, a surfactant, a buffer system, and a stabilizer/osmotic pressure regulator. Further provided are a preparation method for the composition and use of the composition, for example, use in treating tumors, especially multiple myeloma.
Resumen de: WO2025122939A1
There are provided methods for detecting and classifying a B-cell malignancy selected from the group consisting of a B-cell lymphoma, a B-cell leukemia, and a plasma cell dyscrasia in a subject. The methods employ a tumor cell profiling algorithm to analyze single-cell RNA sequencing data obtained from a sample of, e.g., the subject's blood or bone marrow, enriched for a cell type comprising tumoral cells using a cell surface marker. This algorithm identifies one or more one or more expanded clonal cell populations and categorizes each of the one or more expanded clonal cell populations as malignant or pre-malignant tumor cell population if expression of one or more malignancy markers is detected. The one or more malignant or pre-malignant tumor cell population(s) can be analyzed using a statistical model or machine learning algorithm to classify the B-cell malignancy.
Resumen de: WO2025122697A1
Various embodiments of the present disclosure provide determining a clinical diagnosis prediction and/or prognosis prediction with respect to acute myeloid leukemia (AML). A prediction model operating on a computing entity obtains subject data comprising DNA methylation data corresponding to a subject. The prediction model provides the subject data to an input layer of a machine learning-trained model configured to generate a clinical diagnosis prediction and/or a prognosis prediction for the subject based on a learned transformation of the subject data. The prediction model extracts at least one prediction from an output layer of the machine learning-trained model. The prediction model causes the at least one prediction to be provided for human review.
Resumen de: WO2025122569A1
Disclosed is a recombinant T cell receptor that recognizes the KMT2A: :AFF1 fusion neoantigen presented by HLA- DPAl*02 : 01 DPBl*01 : 01, polynucleotides encoding the recombinant T cell receptor, and an expression vector and recombinant host cell comprising such polynucleotides. A method of using the recombinant T cell receptor in adoptive immunotherapy for treating leukemia is also provided.
Resumen de: WO2025121806A1
The present invention relates to a pharmaceutical composition for prevention or treatment of cancer, comprising a BTK degrader and a METTL3 inhibitor, for which it has been confirmed that when a BTK degrader and a METTL3 inhibitor based on proteolysis-targeting chimera (PROTAC) technology are co-administered, a synergistic effect of exhibiting notable anticancer activity is achieved compared to when same are used alone, and thus a prevention or treatment effect on various cancers such as leukemia, lymphoma, lung cancer, pancreatic cancer, and breast cancer may be created.
Resumen de: WO2025121805A1
The present invention relates to a pharmaceutical composition for preventing or treating cancer, the composition comprising an EZH2 inhibitor and a JAK3 inhibitor. When an EZH2 inhibitor and a JAK3 inhibitor based on proteolysis-targeting chimera (PROTAC) technology are co-administered, a remarkable synergistic effect on anticancer activity is exhibited as compared to when either of the inhibitors is administered by itself. Thus, the present invention was found to be able to create a preventive or therapeutic effect on various cancers such as lymphoma, lung cancer, pancreatic cancer, breast cancer, and colorectal cancer.
Resumen de: WO2025121807A1
The present invention relates to a pharmaceutical composition for the prevention or treatment of cancer comprising an EZH2 inhibitor and a METTL3 inhibitor. When co-administered, the EZH2 inhibitor and METTL3 inhibitor based on proteolysis-targeting chimera (PROTAC) technology exhibit a synergistic anticancer effect that is significantly superior to individual treatments, demonstrating that the co-administration can bring about the effects of preventing or treating various cancers such as leukemia, lymphoma, lung cancer, pancreatic cancer, breast cancer, and colorectal cancer.
Resumen de: WO2025122271A1
Described are a method for allogeneic hematopoietic stem cell transplantation (HSCT), a method of treating leukemia, a method of preventing leukemic relapse in a patient in need thereof for at least one year after allogeneic hematopoietic stem cell transplantation comprising administration of a γδ T cell product after the allogeneic HSCT. The invention also encompasses a method of increasing in vivo persistence and expansion of allogeneic γδ T cells administered after allogeneic hematopoietic stem cell transplantation.
Resumen de: WO2025121944A1
The present invention discloses antibodies specifically binding to canine CD20 and uses thereof. The antibody according to the present invention can be used for early diagnosis, disease progression monitoring, and treatment of B-cell lymphoma in dogs.
Resumen de: US2025188177A1
The disclosure provides anti-CD70 antibodies, antigen binding fragments thereof, chimeric antigen receptors (CARs) and engineered T cell receptors (TCRs) comprising an antigen binding molecule that specifically binds to CD70, polynucleotides encoding the same, and in vitro cells comprising the same. The polynucleotides, polypeptides, and in vitro cells described herein can be used in an engineered TCR and/or CAR T cell therapy for the treatment of a patient suffering from a cancer. In one embodiment, the polynucleotides, polypeptides, and in vitro cells described herein can be used for the treatment of multiple myeloma.
Resumen de: US2025188169A1
The disclosure provides method for treating clonal hematopoiesis disorders such as clonal hematopoiesis, myelodysplasia, and leukemia.
Resumen de: US2025186460A1
The present disclosure provides anti-CD19 antibodies and venetoclax for use in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or small lymphocytic lymphoma. The anti-CD19 antibodies, in particular MOR00208, and venetoclax are administered to patients suffering non-Hodgkin's lymphoma (NHL), chronic lymphocytic leukemia (CLL) and/or small lymphocytic lymphoma (SLL) according to a specific treatment paradigm to mitigate therapy associated tumor lysis syndrome.
Nº publicación: US2025189516A1 12/06/2025
Solicitante:
CLEARA BIOTECH B V [NL]
UMC UTRECHT HOLDING B V [NL]
CLEARA BIOTECH B.V,
UMC UTRECHT HOLDING B.V
Resumen de: US2025189516A1
The present invention relates to a method, in particular an in vitro method, for identifying an improved anti-senescence compound based on detecting the binding of said compound in the presence of at least one phosphory lated amino acid in the transcription activation domain (TAD) domain of mammalian protein p53. The present invention further relates to a method, in particular an in vitro method, for monitoring an anti-senescence treatment or prophylaxis in a mammalian subject in need thereof, based on detecting the amount of phosphorylation of amino acids in the TAD and/or C-terminal region of the mammalian p53 protein in a biological sample obtained from said subject and/or detecting the amount and/or co-localization with phosphorylated p53 of the promyelocytic leukemia protein (PML) bodies in a biological sample obtained from said subject. Furthermore, the present invention relates to a kit for performing the above methods as well as respective uses thereof. Finally, improved anti-senescence compounds or pharmaceutical compositions are provided.
BOPI
Sede Electrónica
