Absstract of: WO2024102748A1
Provided herein are methods, diagnostic instruments, and kits for detecting the presence or absence of an analyte associated with a disease in a subject. In some embodiments, the disease is Lyme disease, SARS-CoV-2, or a human immunodeficiency virus infection.
Absstract of: US2024163361A1
To prevent the spread of Covid-19 and other contagious diseases, a touchless handshake is able to be implemented using mobile devices. The touchless handshake is able to be performed by sending a signal from one device to another (or to multiple devices) which triggers the device to vibrate to simulate a handshake. Additionally, mobile devices are able to be used to send and/or display a wave/spin.
Absstract of: US2024161865A1
A method of identifying compounds that reduce main protease (Mpro) activity of a coronavirus is described, which comprises identifying compounds that bind to and stabilize a modified Mpro in an oxidized conformation with a disulfide bond formed between Cys145 (C145) and Cys117 (C117) of Mpro, reducing the catalytic activity of the modified Mpro. The modified Mpro may comprise substitution of a residue at one or both sites of His163 (H163), and/or Phe140 (F140). A modified Mpro enzyme structure (and its in vitro synthesized form) is described, together with a system for screening or designing compounds useful in treatment or prophylaxis of coronavirus infection such as infection from SARS-CoV-2.
Absstract of: US2024158477A1
A nanobody capable of specifically recognizing SARS-CoV-2 spike glycoprotein RBD is provided, and the nanobody comprises a CDR having an amino acid sequence selected from at least one of the following or at least 95% identical to the following: a CDR sequence of a heavy chain variable region: SEQ ID NO: 1 ̃21.
Absstract of: US2024158479A1
This disclosure provides novel potent neutralizing antibodies directed against SARS-CoV-2 Omicron and other variants, related nucleic acids, related cells, related kits, related compositions, and related methods or uses. Also provided in this disclosure are novel combinations of anti-SARS-CoV-2 antibodies that exhibit synergistic effects in neutralizing SARS-CoV-2 variants. Furthermore, this disclosure provides novel chimeric immunogens for inducing effective immune responses against SARS-CoV-2 infections.
Absstract of: US2024158478A1
This disclosure relates to SARS-CoV-2 antibodies disclosed herein and specific binding fragments thereof, therapeutic and diagnostic uses, and compositions related thereto. In certain embodiments, this disclosure relates to antibodies disclosed herein and specific binding fragments thereof wherein the antibody or fragment specifically binds to an epitope expressed on a SARS-CoV-2 particle such as the spike protein or receptor binding domain. In certain embodiments, this disclosure relates to treating or preventing a SARS-CoV-2 or related coronavirus infection comprising administering an effective amount of an antibody disclosed herein or specific binding fragments thereof to a subject in need thereof.
Absstract of: US2024158799A1
The present invention is concerned with the detection of a SARS-Cov-2 vims antigen including, for example, a SARS-Cov-2 virus nucleocapsid protein and/or a SARS-Cov-2 virus spike protein. The present invention provides novel polynucleotide sequences which spontaneously fold to form aptamers having secondary structure features that promote selective binding to a SARS-CoV-2 virus antigen. The present invention further provides test kits and assay methods which employ the polynucleotides described herein, to achieve a more accurate, lower cost, rapid diagnosis COVID-19 test intended to accelerate contact tracing and testing of individuals and the community in the management of the ongoing global pandemic caused by various strains of SARS-CoV-2 virus.
Absstract of: US2024158763A1
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) virus-like particles (VLP) are provided herein as well as methods of making and using the same. The methods of making the VLPs include transfecting a mammalian cell with expression vectors allowing for expression of at least the SARS-CoV-2 M, E and S proteins to make the VLPs. The VLPs can be administered to a subject to induce an immune response against SARS-CoV-2.
Absstract of: US2024159750A1
Methods for diagnosis and treatment of COVID-19 acuity in a subject include the identification of a subject as having Nan increased expression level and/or activity of thymidine phosphorylase in a biological sample obtained from the subject. An effective amount of a therapeutic agent that reduces the expression level or activity of thymidine phosphorylase can the be administered to the subject.
Absstract of: US2024156947A1
Provided herein is a ribonucleic acid (RNA) encoding a spike (S) protein or an immunogenic fragment thereof of a severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) comprising at least one non-naturally occurring amino acid mutation. In some embodiments, the S protein is derived from an Omicron variant. Additionally provided are relevant polynucleotides, vectors, cells, compositions, kits, production methods and methods of use.
Absstract of: US2024156946A1
The present invention is directed to a nucleic acid suitable for use in treatment or prophylaxis of an infection with a coronavirus, preferably with a Coronavirus SARS-CoV-2, or a disorder related to such an infection, preferably COVID-19. The present invention is also directed to compositions, polypeptides, and vaccines. The compositions and vaccines preferably comprise at least one of said nucleic acid sequences, preferably nucleic acid sequences in association a lipid nanoparticle (LNP). The invention is also directed to first and second medical uses of the nucleic acid, the composition, the polypeptide, the combination, the vaccine, and the kit, and to methods of treating or preventing a coronavirus infection, preferably a Coronavirus infection.
Absstract of: US2024156949A1
The present invention is directed to nucleic acids suitable for use in treatment or prophylaxis of an infection with a coronavirus, such as a Coronavirus SARS-CoV-2 variant, or a disorder related to such an infection, such as COVID-19. The present invention is also directed to compositions, and vaccines. The compositions and vaccines comprise at least one of said nucleic acid sequences, and nucleic acid sequences in association with a lipid nanoparticle (LNP). The invention is also directed to first and second medical uses of the nucleic acids, the composition, the vaccine, and the kit, and to methods of treating or preventing a coronavirus infection, such as a Coronavirus infection from a SARS-CoV-2 variant.
Absstract of: US2024156960A1
The present invention provides compositions, systems, kits, and methods for expressing at least one therapeutic protein or biologically active nucleic acid molecule in a subject. In certain embodiments, the subject is first administered a composition comprising polycationic structures that is free, or essentially free, of nucleic acid molecules, and then (e.g., 1-30 minutes later) is administered a composition comprising a plurality of one or more non-viral expression vectors that encode at least one therapeutic protein (e.g., at least one anti-SARS-CoV-2 antibody, multiple different antibodies, an ACE2 protein, or human growth hormone) or a biologically active nucleic acid molecule.
Absstract of: AU2022358202A1
Disclosed are a recombinant fusion protein derived from an HR region of an S2 protein of SARS-CoV-2 and an application of the recombinant fusion protein. The SARS-CoV-2 recombinant fusion protein is a recombinant fusion protein obtained by linking two membrane fusion-related conserved amino acid sequences HR1 and HR2 of the SARS-CoV-2 membrane protein S2 protein by means of a linking peptide. The recombinant fusion protein can be induced and expressed in Escherichia coli, has high expression quantity, and is easy to purify. The SARS-CoV-2 recombinant fusion protein provided by the present invention can form and maintain a stable dimer structure, simulates the conformation of a SARS-CoV-2 membrane fusion intermediate state, can be used as a detection raw material for detecting a SARS-CoV-2 membrane fusion process, has good anti-SARS-CoV-2 activity and good immunogenicity, and has a wide application prospect in the fields of development of drugs for preventing or treating SARS-CoV-2 proteins and development of SARS-CoV-2 vaccines and anti-SARS-CoV-2 antibodies.
Absstract of: AU2022375406A1
A purpose of the present invention is to provide a novel SARS-CoV-2 proliferation inhibitor and a novel COVID-19 onset preventing agent. The present invention provides a SARS-CoV-2 proliferation inhibitor including a lactic acid bacterium as an active ingredient. The present invention also provides a COVID-19 onset preventing agent including a lactic acid bacterium as an active ingredient. The lactic acid bacterium as an active ingredient according to the present invention is preferably Lactococcus lactis subsp. lactis. An agent according to the present invention is preferably in the form of a food composition.
Absstract of: WO2024102839A1
Compositions, assays, methods, diagnostic methods, kits, and diagnostic kits are disclosed for the specific and differential detection of SARS-CoV-2, Flu A, Flu B, RSV A, and RSV B from samples, including veterinary samples, clinical samples, food samples, forensic sample, environmental samples (e.g., obtained from soil, garbage, sewage, air, water, food processing and manufacturing surfaces, or likewise), or biological sample obtained from a human or non-human animal. The compositions, assays, methods, diagnostic methods, kits, and diagnostic kits provide materials and method steps for differential detection of any one of SARS-CoV-2, Flu A, Flu B, RSV A, and RSV B in a single multiplex assay.
Absstract of: WO2024102674A1
The disclosure provides, in various embodiments, polypeptides (e.g, antibodies and antigen binding fragments thereof) that specifically bind to receptor binding domains (RBDs) of betacoronavirus Spike glycoproteins, such as severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) Spike glycoproteins. The disclosure also provides, in various embodiments, fusion proteins comprising one or more of polypeptides, polynucleotides encoding polypeptides, vectors and host cells suitable for expressing polypeptides, and methods for treating viral infections (e.g., COVID-19).
Absstract of: WO2024102999A2
Disclosed herein are small molecules that effectively block the interaction of SARS-CoV-2 Spike protein with ACE2. Also disclosed are methods for treating viral infections that involve entry via endocytic pathways. In one aspect, the small molecules effectively block viral entry by targeting the interaction of SARS-CoV-2 Spike protein with ACE2. The two significant advantages of disclosed approach are: 1) small molecule inhibitors that target surface exposed proteins such as the Spike protein are not constrained by limited cell permeability/localization, and 2) structure-guided screening approaches avoid the necessity of screening large chemical libraries, thus expediting drug discovery and development. By blocking the essential interactions of the viral Spike protein with ACE2 using small molecule inhibitors, viral entry/fusion and subsequent infectivity of SARS-CoV-2 can be prevented.
Absstract of: WO2024102986A2
The present disclosure relates to certain molecules, pharmaceutical compositions containing them, and methods of using them to treat viral infections.
Absstract of: WO2024102989A1
The present disclosure relates to certain molecules, pharmaceutical compositions containing them, and methods of using them to treat viral infections.
Absstract of: WO2024102865A2
Provided herein is a synthetic polypeptide derived from High Mobility Group Box 1 (HMGB 1) host protein that can both disrupt bacterial biofilms and prevent Neutrophil Extracellular Trap (NET) formation. Also provided herein are methods to disrupt aberrant or excessive NET formation that are particularly well-suited to treat high-risk populations such as those infected with SARS CoV-2, sepsis, autoimmune diseases e.g., systemic lupus erythematosus, rheumatoid arthritis, Type I diabetes mellitus, small vessel vasculitis, autoinflammatory diseases e.g., gout, inflammatory bowel disease, and metabolic diseases e.g., Type 2 diabetes and obesity.
Absstract of: WO2024102455A1
Non-covalent inhibitors of coronavirus main protease and pharmaceutical formulations thereof are disclosed. The compounds and pharmaceutical formulations disclosed herein can be used to treat or prevent coronavirus infection, especially SARS-CoV-2 infection.
Absstract of: WO2024102104A1
The invention relates to a point-of-care device that can be used for SARS-CoV-2 detection based on a loop-mediated isothermal amplification protocol and with an automatic image processor.
Absstract of: WO2024101762A1
The present invention relates to an antibody specifically binding to SARS-CoV-1, or an antigen-binding fragment thereof. The antibody is selected from the group consisting of: a variable region comprising CDR1 of SEQ ID NO: 1, CDR2 of SEQ ID NO: 2, and CDR3 of SEQ ID NO: 4; and a variable region comprising CDR1 of SEQ ID NO: 1, CDR2 of SEQ ID NO: 2, and CDR3 of SEQ ID NO: 7.
Absstract of: WO2024100583A1
The present disclosure relates to a fusion protein comprising an ectodomain of a viral fusion protein linked to one or more heptad repeat(s) (HR(s)) from a SARS-COV-2 spike (S) protein or a respiratory syncytial virus (RSV) F protein, and the uses thereof. The viral fusion proteins are suitable for use as vaccines.
Absstract of: AU2022374853A1
The present invention provides neutralizing monoclonal antibodies targeting the spike protein of Sarbecoviruses, such as Severe Acute Respiratory Syndrome-Coronavirus-2 (SARS-CoV-1 or SARS-CoV-2 like COVID-19). The monoclonal antibodies of the invention can inhibit or neutralize SARS-CoV-1 or SARS-CoV-2 activity and advantageously be used for treating, preventing or diagnosing COVID-19 infection in humans due to their significant cross-reactivity among SARS-CoV-2 variants.
Absstract of: AU2022379143A1
Trypsin/trypsin-like proteases have been reported to be facilitating SARS-CoV-2 entry into host cells. Spike has protease cleavage sites between the S1 and S2 domains. Cleavage property of proteases can be used to design drug screening assays meant for screening antiviral candidates against spike cleavage. In the claimed invention we have developed a proof-of-concept assay system for screening drugs against proteases which cleave spike between S1 and S2. We designed a fusion substrate protein containing a reporter protein, the protease cleavage site between S1 and S2 and a cellulose binding domain. The substrate protein can be immobilized on cellulose due to the presence of cellulose binding domain (CBD). When proteases cleave the substrate, CBD remains bound to cellulose and the reporter protein is dislodged. The released reporter can be used as read out of protease activity.
Absstract of: WO2023283651A1
The disclosure relates to pan human coronavirus ribonucleic acid (RNA) vaccines as well as methods of using the vaccines and compositions comprising the vaccines.
Absstract of: GB2624353A
Inflammatory disorders of the lung are induced by COVID-19 disease, asthma, and numerous other disorders. Omega- 3 fatty acids (O3FA), particularly docosahexaenoic acid (DHA), docosapentaenoic acid (DPA) or eicosapentaenoic acid (EPA), have known anti-inflammatory and pro-resolving properties. Reduction of lung pathology and inflammation will be accomplished by a mixture incorporating O3FA that is suitable for nebulization using formulas and nebulization apparatus known in the art. The O3FA may be delivered in the form of ethyl esters (EE) or free fatty acid (FEA) oils or non- phosphate- containing glycerolipids or as phospholipids (PL) or as any other form known in the art. The mixture can also be delivered in any of the other forms of inhaled droplet or solids for inhalation known in the art. The patient will inhale for a therapeutically effective period of time to reduce inflammation and improve breathing.
Absstract of: CA3229050A1
Described herein are modified SARS-CoV-2 variants. These viruses have been recoded, for example, codon deoptimized or codon pair bias deoptimized and are useful for reducing the likelihood or severity of a SARS-CoV-2 variant infection, preventing a SARS-CoV-2 variant infection, eliciting and immune response, or treating a SARS-CoV-2 variant infection.
Absstract of: EP4368631A1
Provided is a peptide capable of binding to a receptor binding domain (RBD) in SARS-CoV-2, chemically synthesized easily, having extremely high solubility to ultra-pure water or a buffer solution and a high possibility of being put to practical use as a therapeutic drug for COVID-19.
Absstract of: EP4368141A2
Disclosed herein are protective apparatuses, and associated systems, for minimizing the risk of transmission of SARS-CoV-2 and/or other infectious diseases between individuals in close proximity to one another including, for example, transmission through droplets projecting from the mouth or nasal region of an infected individual. Said apparatuses may comprise a substantially transparent shield component and a handle component comprising a connecting aspect. The protective apparatuses may comprise light emitting diodes and associated control means. The protective apparatuses of the present disclosure may further comprise a camera communicatively connected to a display screen.
Absstract of: US11980485B1
A method and system for determining a treatment outcome prediction for a patient using electroencephalograph (EEG) are disclosed, which include analyzing a brain region mutual interaction characteristics using scalp EEG data from a patient and obtaining a set of brain region mutual interaction feature matrices, performing a feature enhancement process to the brain region mutual interaction feature matrices to extract prominent mutual interaction features and applying a treatment response predictive model to determine a treatment outcome prediction for the patient. Further disclosed is a method of generating a treatment response predictive model using EEG dataset of a group of patients under a clinical treatment. The method and system can be used for determining a treatment outcome prediction for a psychiatric disorder patient and a patient diagnosed with COVID-19 and suffering from psychiatric disorder symptom(s) originated from COVID-19.
Absstract of: WO2024096886A1
The covid-19 coronavirus has killed more than 5,129,829 people, globally, out of about 255,098,687 infected. About 10 million persons died from cancer in 2020, with 19.3 new cases diagnosed. About 409,000 persons died of malaria in 2019. And none of these diseases made the WHO's list of top 5 deadly diseases of 2019. Modern medicine has made tremendous progress in the prevention and treatment of disease, but the crashing of the covid-19 coronavirus and the extremely high burden of the top deadly diseases point to the urgency of radical and totally disrupting inventions in medicine. Indeed, to effectively overcome the current burden of deadly diseases we need an agile platform with exponentially better efficacy and predictability. The world is in dire need of a new medicine platform that totally and radically disrupts the current healthcare systems and the traditional ways of preventing and treating disease. The present invention does that. The present invention uses transformed microbes, targeted to one or more mucosal surface, to prevent and treat just about any disease of importance. The current means of disease prevention relies on vaccines. As we have seen from countless failures and booster shots, vaccines have extreme limitations and increasingly fewer following. Firstly, vaccine development is unpredictable, lengthy and costly. An important lesson of the covid-19 pandemic is that waiting for several months or years to develop a vaccine, while a disease ravages the popu
Absstract of: WO2024093910A1
Provided are an antiviral-based hand sanitizer and use thereof. The hand sanitizer possesses antibacterial and antiviral effects and a good killing effect against common bacteria and fungi such as Escherichia coli, Staphylococcus aureus, and Candida albicans. The addition of antivirals imparts to the hand sanitizer protective functionality against SARS-CoV-2 and other coronaviruses and the effect of protecting the hand skin due to the non-irritative nature of proteins.
Absstract of: WO2024094050A1
The present invention relates to universal sarbecovirus vaccines that specifically express an interferon. This live universal sarbecovirus vaccine elicits mucosal immunity and heterotypic immunity against various sarbecoviruses, including SARS-CoV-1, SARS-CoV-2, and its variants. Interferon directly encoded from the genome of the live universal sarbecovirus overrides the virus-induced "delayed type-I interferon", resulting in enhancement of mucosal T cell responses. The present invention further relates to uses of the vaccines for the preparation of pharmaceutical compositions, methods of treating or preventing viral infections, and kits comprising the vaccines.
Absstract of: WO2024096743A1
The invention is in the field of medical treatment, and relates to a method for treating SARS-CoV-2 infections. In particular, the present invention relates to methods for prophylactic and/or therapeutic treatment of betacoronavirus infections, in particular, SARS-CoV-2 infections by means of intranasal administration or oral inhalation of antibodies.
Absstract of: WO2024096742A1
The invention is in the field of medical treatment, and relates to a method for treating SARS-CoV-2 infections. In particular, the present invention relates to methods for prophylactic and/or therapeutic treatment of betacoronavirus infections, in particular, SARS-CoV-2 infections by means of intranasal administration or oral inhalation of polypeptides.
Absstract of: WO2024097908A1
The present invention is generally directed to a potent therapy for SARS-CoV-2 (CoV2) disease which involve combinations of agents. Here we describe combinations of 2 drugs wherein the combination inhibits CoV2 replication through one or more mechanisms of action and increases potency of nucleoside and nucleotide analog drugs through inhibition of cellular enzymes involved in purine nucleotide biosynthesis. The combinations may be delivered as individual doses, concurrent dosing, or co-formulation of 2 or more agents. The invention provides of a defined combination of one or more drugs targeting viral components plus one or more drugs targeting cellular enzymes, in a fixed ratio with a specified therapeutic regimen.
Absstract of: WO2024097731A2
The invention relates to methods for treating COVID-19 by targeting the inflammasome/caspase1/pyroptosis axis as a key inflammatory pathway. In particular, the invention relates to treating a patient infected with SARS-CoV-2 with an effective amount of one or more compounds that directly or indirectly inhibit one or more pathways of the inflammasome/caspase1/pyroptosis axis.
Absstract of: WO2024097259A1
Provided herein is a ribonucleic acid (RNA) encoding a spike (S) protein or an immunogenic fragment thereof of a severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) comprising at least one non-naturally occurring amino acid mutation. In some embodiments, the S protein is derived from an Omicron variant. Additionally provided are relevant polynucleotides, vectors, cells, compositions, kits, production methods and methods of use.
Absstract of: WO2024097660A2
Monoclonal antibodies that specifically bind to and block the function of Fas ligand (FasL) are described. The FasL-specific antibodies can be used for the development of therapeutics for the treatment of diseases, disorders and conditions associated with the Fas/FasL signaling pathway, such as cancer, sepsis, ischemia-reperfusion injury, and coronavirus disease 2019 (COVID-19).
Absstract of: US2024148864A1
Provided herein are adjuvantation systems comprising fungal polysaccharides for use in Beta coronavirus (e.g., MERS-CoV, SARS-CoV-1, or SARS-CoV-2) and influenza (influenza A virus and influenza B virus) vaccines and immunogenic compositions comprising the adjuvantation system and a Beta coronavirus or influenza virus antigen.
Absstract of: US2024148859A1
The present technology generally relates to a microorganism displaying antigenic proteins of the SARS-CoV2 coronavirus on its surface, to methods of preparing same, to composition comprising such microorganism and to methods for treatment of SARS-CoV2 related infections in subjects.
Absstract of: US2024148820A1
Broad spectrum antiviral peptides and composition including therapeutically effective amounts of the antiviral peptides along with a pharmaceutically acceptable carrier are provided. The antiviral compositions show a strong broad spectrum antiviral effect, without resulting in viral resistance. Preferably, the antiviral compositions contain P16 or a P16-like peptide which can both inhibit viral fusion and endosomal acidification to prevent viral entry through the endocytic pathway. The antiviral compositions can be used in methods of treating diseases caused by viral infections, particularly respiratory viruses such as enveloped coronaviruses (SARS-CoV-2, SARS-CoV and MERS-CoV), the pandemic A(H1N1)pdm09 virus, avian influenza A(H7N9) virus, and the non-enveloped rhinovirus. The compositions are administered in a subject in need thereof in an effective amount to reduce or prevent viral replication in the subject, and thus reduce one or more symptoms of disease, disorder, or illness associated with virus.
Absstract of: US2024148763A1
The present invention relates to the use of compositions comprising sialic acid to inhibit or treat coronavirus infections, and in particular those caused by SARS-CoV-2 (Severe Acute Respiratory Syndrome Coronavirus 2).
Absstract of: US2024148783A1
EGCG-Zn2+ molecular complexes exhibit a significantly higher affinity than the EGCG molecule alone or Zn2+ alone for binding to different SARS-CoV-2 molecular targets and show virtually complete antiviral suppressive activity (>99%) against this virus in experimental models of infection. EGCG-Zn2+ complexes have a lower toxicity than EGCG alone in transfected human cells. The combination of EGCG and Zn2+, significantly improved some key pharmacokinetic parameters of EGCG in humans. Thus, these complexes can be used as a new broad-spectrum method for chemoprophylaxis or treatment of viral diseases by using formulations containing a composition of EGCG and Zn2+ or EGCG-Zn2+ complexes in sufficient amount to reach a blood concentration with antiviral effect, minimizing safety issues in humans.
Absstract of: US2024148769A1
The present invention relates to a pharmaceutical composition for preventing or treating coronavirus disease 19 (COVID-19) and specifically, to a pharmaceutical composition containing a carbocyclic nucleoside derivative represented by Chemical Formula A-1 or A-2 or a pharmaceutically acceptable salt thereof.
Absstract of: US2024148768A1
A method of treating an individual infected with COVID-19, the method comprising the steps of: providing an individual infected with COVID-19; and administering five antimicrobials to the individual, wherein the antimicrobials comprise: hydroxychloroquine; azithromycin; vitamin C; vitamin D; and zinc.
Absstract of: US2024148682A1
A method for regulating a downstream signaling pathway mediated by an activation of a trimethylamine-N-oxide includes administrating an omega-3 polyunsaturated fatty acid to a subject in need thereof. The omega-3 polyunsaturated fatty acid is for inhibiting an inflammatory response, for inhibiting an infection of a SARS-CoV-2 to a cell, for reducing an oxidative stress level in the cell, for alleviating an impairment of neovascularization, or for inhibiting a vascular fibrogenesis.
Absstract of: US2024148274A1
Methods and devices for capturing and analyzing aerosolized particles in exhaled breath characteristic of a respiratory disease to enable rapid, low-cost point of care assays for several diseases including respiratory tract diseases such as COVID-19 are disclosed. The disclosed methods and systems selectively capture aerosolized particles using a packed bed column. The captured particles are then eluted using solvents and analyzed using analytical devices including MALDI-TOFMS.
Absstract of: US2024147927A1
Provided herein are systems and methods for enhancement of polyphenols, such as chlorogenic acids, chicoric acid, anthocyanins, and water-soluble quercetin derivatives, production in red lettuces. Also provided are transgenic lettuce for the production of polyphenols. Also provided are parts of such transgenic lettuces, such as seeds leaves, and extracts. The disclosure also provides methods of using the new lettuces and parts thereof for protection against viral/bacterial infection (i.e., by inhibiting activities of COVID-19 virus/enzymes) diabetes, cardiovascular diseases, memory and eyesight loss, inflammation, and cancer.
Absstract of: AU2022381515A1
This invention relates to immunogenic constructs, such as polynucleotides, polypeptides and multimeric proteins and to antigenic units and to pharmaceutical compositions/vaccines comprising such immunogenic constructs or antigenic units, which are useful for the prophylactic and therapeutic treatment of diseases caused by severe acute respiratory coronavirus 2 (SARS-CoV-2), as well as methods for producing and using the immunogenic constructs, antigenic units and pharmaceutical compositions/vaccines.
Absstract of: AU2022366615A1
The present invention relates to a gene construct for expressing an mRNA, and a pharmaceutical composition, a vaccine composition, and a gene therapy composition, each comprising the gene construct. More specifically, the present invention relates to a gene construct including a coronavirus (SARS-CoV-2: Severe acute respiratory syndrome coronavirus 2)-derived 5' untranslated region (UTR) and/or 3' untranslated region (UTR), and a pharmaceutical composition, a vaccine composition, and a gene therapy composition, each comprising the gene construct.
Absstract of: US2024150494A1
This disclosure is based, at least in part, on an unexpected discovery that the novel nanobodies and variants thereof are able to specifically bind afucosylated or sialylated IgG Fc glycoforms. Glycosylation of the IgG Fc domain is a major determinant of the strength and specificity of antibody effector functions, modulating the binding interactions of the Fc with the diverse family of Fcγ receptors. These Fc glycan modifications, such as removal of the core fucose residue, are newfound clinical markers for predicting severity of diseases, such as diseases caused by dengue virus (DENV) or SARS-CoV-2. However, it remains challenging to accurately distinguish specific IgG glycoforms without costly and time-intensive methods. The novel glycol-specific nanobodies and variants thereof, as disclosed herein, can be used as rapid clinical diagnostics or prognostics to risk stratify patients with viral and inflammatory diseases.
Absstract of: US2024150318A1
Provided herein are compounds of Formula (I), their pharmaceutically acceptable salts, and their pharmaceutical compositions:wherein R1, R2, R3a, R3b, R4, R5, and A are defined in the present disclosure. The compounds are potent inhibitors of the main protease (Mpro) of severe acute respiratory syndrome Coronavirus-2 (SARS-CoV-2), and they are useful in treating or preventing COVID-19 in a subject.
Absstract of: US2024150441A1
The present invention provides monoclonal antibodies against SARS-CoV-2 and methods of use and making thereof.
Absstract of: US2024150440A1
The present disclosure relates to single domain antibodies (“VHHs”) against SARS-CoV-2, as well as to polypeptides comprising one or more of such VHHs. The disclosure also relates to nucleic acids encoding such VHHs and polypeptides; to methods of preparing such VHHs and polypeptides; to host cells expressing or capable of expressing such VHHs or polypeptides; to compositions comprising such VHHs, polypeptides, nucleic acids or host cells; and to uses of such VHHs, such polypeptides, such nucleic acids, such host cells or such compositions, in particular for prophylactic, therapeutic or diagnostic purposes.
Absstract of: US2024150438A1
Antibodies that bind SARS-CoV spike protein, SARS-CoV-2 spike protein, and methods of using same for treating or preventing conditions associated with SARS or COVID-19 and for detecting SARS-CoV or SARS-CoV-2.
Absstract of: US2024150439A1
This disclosure provides novel broadly neutralizing anti-SARS-CoV-2 antibodies or antigen-binding fragments thereof. The disclosed anti-SARS-CoV-2 antibodies constitute a novel therapeutic strategy in protection from SARS-CoV-2 infections.
Absstract of: US2024150398A1
The present invention provides peptides and conjugates thereof, as ACE-2 and S1 subunit mimicking peptides for the prevention and control of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS-CoV2) infection by preventing the binding of Severe Acute Respiratory Syndrome Coronavirus-2 to the target cells.
Absstract of: US2024148858A1
There are provided herein, inter alia, complexes, compositions and methods for a vaccine for COVID-19. The cell-penetrating complexes provided herein may include a nucleic acid non-covalently bound to a cationic amphipathic polymer, the cationic amphipathic polymer including a pH-sensitive immolation domain. The cell-penetrating complexes provided herein are, inter alia, useful in vaccines, wherein the vaccine includes a ribonucleic acid including a sequence encoding a viral protein, a nucleic acid adjuvant and a cationic amphipathic polymer provided herein including embodiments thereof.
Absstract of: EP4365195A1
The purpose of the present invention is to provide an antibody that enables simple, rapid and sensitive detection of SARS-COV-2, i.e., the causative virus of COVID-19 while suppressing nonspecific reactions, and an immunological detection method and a kit comprising the antibody. By using an antibody that binds to the nucleocapsid protein of SARS-COV-2 or an antibody fragment thereof, in particular, an antibody that recognizes a specific region of the protein or an antibody fragment thereof, provided are a specific and sensitive immunological detection method and kit, in particular, a detection method using a sandwich method such as an immunochromatography method or ELISA method, as well as immunochromatographic test strip containing the antibody and a kit containing the test strip.
Absstract of: US2024139311A1
A recombinant vesicular stomatitis vims (rVSV) carrying one or more genes that encode for the spike protein of SARS-CoV-2 or for both the S protein and the envelope protein of the SARS-CoV-2. Vaccines, regimens and kits having the rVSV are used for the prevention of infections caused by SARS-CoV-2.
Absstract of: US2024139309A1
The disclosure provides coronavirus mRNA vaccines, including vaccines directed against spike proteins of one or more variant strains of SARS-CoV-2, as well as methods of using the vaccines.
Absstract of: US2024139483A1
The present invention provides a method for generating an immune response in a subject, comprising administering to the subject's skin an immunizing composition from a Severe Acute Respiratory Syndrome Coronavirus 2 (SARS-CoV-2) pathogen, wherein the composition is administered with a microneedle deliver adapter device, and wherein the immunizing composition comprises a heat killed or attenuated pathogen.
Absstract of: US2024139307A1
The present invention relates to universal sarbecovirus vaccines that specifically express an interferon. This live universal sarbecovirus vaccine elicits mucosal immunity and heterotypic immunity against various sarbecoviruses, including SARS-CoV-1, SARS-CoV-2, and its variants. Interferon directly encoded from the genome of the live universal sarbecovirus overrides the virus-induced “delayed type-I interferon”, resulting in enhancement of mucosal T cell responses. The present invention further relates to uses of the vaccines for the preparation of pharmaceutical compositions, methods of treating or preventing viral infections, and kits comprising the vaccines.
Absstract of: US2024139296A1
The present invention relates to pharmaceutical compositions of ACE2 Fc fusion proteins and therapeutic uses thereof, in particular in the treatment of infections with SARS-CoV-2.
Absstract of: US2024140975A1
The present invention relates to an antiviral application of nucleoside analogs. Specifically, the present invention relates to uses of nucleoside analogs and a pharmaceutical composition thereof as: (a) inhibitors for inhibiting the replication of coronaviruses, influenza viruses, respiratory syncytial viruses, flaviviridae viruses, filoviridae viruses and/or porcine epidemic diarrhea virus (PEDV); and/or (b) medicines for treating and/or preventing and mitigating diseases caused by coronavirus, influenza virus, respiratory syncytial virus, flaviviridae virus, filoviridae virus and/or porcine epidemic diarrhea virus (PEDV) infections. The nucleoside analogs according to the invention may treat and/or prevent and mitigate respiratory infection, pneumonia (COVID-19) and other related diseases caused by 2019 novel coronavirus infection.
Absstract of: US2024139742A1
The planetary outbreak of COVID-19 has led to a substantial death toll and has hindered the functioning of modern society. This underlines the importance of accurate, cost-effective serological antibody tests and point-of-care diagnostics to monitor the viral spread and to contain pandemics and endemics. This requires a cost-effective three-dimensional nanofluidic device for rapid and multiplexed detection of viral antibodies. The device is configured to size-dependently immobilize particles at predefined positions from a multiparticle mixture, giving rise to distinct trapping lines. It is shown with the device that distinctive lines can be used as an on-chip and on-bead fluorescent linked immunosorbent assay for the detection of immunoglobulin G (IgG) antibodies against the receptor-binding domain of SARS-CoV-2 in human serum. Device versatility is exhibited by on-bead color multiplexing for simultaneous detection of IgG and IgM in convalescent human serum and by concurrent detection of anti-spike (SARS-CoV-2) and anti-hemagglutinin (Influenza A) antibodies.
Absstract of: WO2024091923A1
The present invention relates to methods for monitoring the immune status of a population by detecting and/or quantifying antibodies present in wastewater. The invention further provides methods and kits for monitoring the presence of an antibody to SARS-CoV-2 or a variant thereof within a population by detecting and/or quantifying SARS-CoV-2-specific antibodies in wastewater.
Absstract of: WO2024091258A1
Disclosed herein are subcutaneously administered, immunogenic compositions (e.g., vaccines) and methods of using and preparing the same. In some embodiments, the immunogenic compositions generate IgG antibodies to the spike proteins of the Wuhan-Hu- 1, Delta B.1.617.2, and Omicron BA. l variants of SARS-CoV-2 and may be suitable for use in preventing an infectious disease, such as SARS-CoV-2.
Absstract of: WO2024089627A1
The invention provides a set of new single domain antibodies - sdAb/Vhh against the nucleoprotein (N) of SARS-CoV-2 and their use for diagnostic, therapeutic and prophylactic applications. Wherein the Vhh is selected from Vhh1 and/ or Vhh2 wherein the Vhh1 comprises 3 CDR having at least a 90% identity with aminoacidic sequence according to SEQ ID No 5, 6 and 7, and Vhh2 comprises 3 CDR having at least a 90% identity with aminoacidic sequence according to SEQ ID No 8, 9 and 10.
Absstract of: WO2024088403A1
The present invention relates to a new use of an isoquinoline alkaloid and a pharmaceutically acceptable salt thereof in medicine, and in particular to a use of an isoquinoline alkaloid compound and a pharmaceutically acceptable salt thereof in the prevention, alleviation and/or treatment of SARS-CoV-2 viral infectious diseases. Experimental results show that the isoquinoline alkaloid obviously inhibits virus infection and replication on an anti-SARS-CoV-2 virus drug screening model, i.e., pangolin coronavirus strain xCoV, a SARS-CoV-2 virus-like particle (trVLP) system, and a VSV pseudovirus system. The isoquinoline alkaloid inhibits virus replication by inhibiting the whole life cycle of the virus, and the results strongly indicate the potential clinical application values of the isoquinoline alkaloid for diseases caused by the currently popular novel coronavirus and other coronaviral infections.
Absstract of: AU2022400924A1
Recombinant SARS-CoV2 vaccine compositions and methods are presented that have unexpected cross-reactivity against a variety of other coronaviruses, and particularly against SARS-CoVl, MERS-CoV, OC43-CoV, and HKUl-CoV in addition to significant reactivity against SARS-CoV2A. Moreover, the vaccine compositions presented herein also produced cross-reactive memory B cells as well as cross-reactive memory T cells with cross-reactivity spanning a relatively wide range of different coronaviruses.
Absstract of: AU2022378932A1
The present disclosure relates to methods for treating infectious disorders. In particular, the disclosure provides BTN3A activating antibodies, and their use in treating infectious disorders in a human subject in need thereof, such as disorders caused by SARS-Cov2 or Coxiella burnetii infection.
Absstract of: AU2022395939A1
The present invention relates to the field of RNA editing using novel Cast 3 polypeptides in a CRISPR/Cas13 system. The novel Cast 3 polypeptides have collateral, or 'trans' cleavage activity and can be utilised in a nucleic acid detection systems, such as a Cast 3 SARS-CoV-2-based detection assay.
Absstract of: AU2022371744A1
Specifically disclosed are a core amino acid sequence group for the targeted recognition of anti-SARS-CoV-2 neutralizing antibodies N-IgY-pAbs, and the use thereof. The core amino acid sequence group for the targeted recognition of the anti-SARS-CoV-2 neutralizing antibodies N-IgY-pAbs comprises 15 amino acid sequences located in an S-ECD domain and 5 amino acid sequences located in a non-structural protein (NSP) domain, and can be applied to the detection of SARS-CoV-2, and the designing of treatment targets and designing of vaccine targets. In the above amino acid sequence group, it is found that P272 in only one aa261-275 sequence of an S protein is a residue with a low-frequency mutation, and the remaining 19 sequences are conservative amino acid sequences, do not contain the currently discovered virus mutation sites, and are highly conservative, which can effectively cope with the unfavorable situation of high-frequency mutation of SARS-CoV-2 at present.
Absstract of: AU2022361924A1
The devices and methods of the present invention can be used to capture and remove COVID-19 mediating nanoparticles and/or exosomes associated with COVID-19 or similar disease from the circulatory system of patients in need thereof, including those with post COVID-19 syndrome or similar post-disease sequelae symptoms of COVID-19 or similar disease. The present invention provides a lectin based extracorporeal methods for binding and physically removing SARS-CoV-2 virions, or fragments thereof such as SARS-Co V-2-derived glycoproteins, from the circulatory system, thereby reducing viral load in infected blood. The present invention also provides lectin based extracorporeal methods of binding and physically removing non-viral COVID-19 mediating nanoparticles, such as exosomes containing SARS-Co V-2-derived glycoproteins and/or other biological molecules from the circulatory system, thereby reducing the severity of the disease.
Absstract of: AU2022358743A1
The present disclosure relates to anti-SARS-COV-2 antibodies and uses thereof in detecting intact multimeric and/or intact trimeric severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike protein in a sample.
Absstract of: AU2022347195A1
SARS-Co V-2 is a novel coronavirus that has subsequently spread globally to cause the COVID-19 pandemic. The present invention provides constructs of the parainfluenza virus type-5 (PIV5) virus expressing the SARS-Co V-2 envelope spike (S) and nudeocapsid (N) proteins of SARS-Co V-2 variants for use as safe, stable, efficacious, and cost-effective vaccines against COVID-19.
Absstract of: AU2022361501A1
The present disclosure relates to proteins which bind to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and uses thereof.
Absstract of: WO2024089638A1
The present invention is directed to nucleic acids suitable for use in treatment or prophylaxis of an infection with a coronavirus, such as a Coronavirus SARS-CoV-2 variant, or a disorder related to such an infection, such as COVID-19. The present invention is also directed to compositions, and vaccines. The compositions and vaccines comprise at least one of said nucleic acid sequences, and nucleic acid sequences in association with a lipid nanoparticle (LNP). The invention is also directed to first and second medical uses of the nucleic acids, the composition, the vaccine, and the kit, and to methods of treating or preventing a coronavirus infection, such as a Coronavirus infection from a SARS-CoV-2 variant.
Absstract of: WO2024089277A2
The present invention relates to antibodies capable of binding to the spike protein of coronavirus SARS-CoV-2, and methods and uses thereof in the prevention, treatment and/or diagnosis of coronavirus infections, and diseases and/or complications associated with coronavirus infections, including COVID-19.
Absstract of: WO2024089159A1
The invention relates to compounds of formula (I) wherein R1, R2, R3 and R4 are as defined herein, pharmaceutical compositions comprising the compounds and methods for synthesising compounds according to formula I. This invention further relates to methods of treating COVID-19 in a patient by administering therapeutically effective amounts of the compounds and methods of inhibiting or preventing replication of SARS-CoV-2 with the compounds on the invention and uses of the compounds of the invention in the these methods and in the manufacturing of a medicament.
Absstract of: US2024139334A1
The present disclosure is directed to engineered nanoparticles/liposomes that inhibit enveloped viruses and methods for use thereof.
Absstract of: US2024139312A1
Vaccine compositions comprising at least one modified immunogen via in vitro glycosylation methods that provide a rational approach for generating glycosylated versions of immunogens via the reducing end of a linear carbohydrate, the reducing end containing an N-acyl-2-amino moiety. Vaccine compositions comprising a plurality of heterologous immunogens associated with a multivalent carrier, wherein at least one immnunogen is glycosylated. Vaccine compositions comprising multivalent carriers and related methods using the vaccine compositions in various therapeutic and prophylactic applications for inducing an immune response against, treating, or preventing a bacterial, viral, fungal, or protozoan infection. Pathogens for which this approach may be useful include, but are not limited to, influenza viruses, rhinoviruses, human immunodeficiency viruses (HIV), respiratory syncytial virus (RSV), coronaviruses, Babesia, Borrelia, Neisseria, and Chlamydia, and the related diseases thereof
Absstract of: AU2021470029A1
This disclosure relates to the field of RNA to prevent or treat coronavirus infection. In particular, the present disclosure relates to methods and agents for vaccination against coronavirus infection and inducing effective coronavirus antigen-specific immune responses such as antibody and/or T cell responses. Specifically, in one embodiment, the present disclosure relates to methods comprising administering to a subject RNA encoding a peptide or protein comprising an epitope of SARS-CoV-2 spike protein (S protein) for inducing an immune response against coronavirus S protein, in particular S protein of SARS-CoV-2, in the subject, i.e., vaccine RNA encoding vaccine antigen.
Absstract of: WO2024089454A1
The present invention relates to a composition, preferably a nutraceutical composition, for use in a method of treatment of post viral infection caused by the virus strain called SARS-CoV-2, or alternatively COVID- 19, chronic fatigue/fatigue.
Absstract of: EP4361170A1
The invention provides an antibody-inducing polypeptide that is useful for treatment or prevention of SARS-CoV-2 infection in a subject and a vaccine that comprises such antibody-inducing polypeptide. The polypeptide is selected from the group of polypeptides (a) to (f) below and has antibody-inducing properties: (a) a polypeptide consisting of 7 or more continuous amino acids in a region of positions 336 to 361, 406 to 432, or 446 to 480 of SEQ ID NO: 1; (b) a polypeptide comprising an amino acid sequence having 80% or higher sequence identity to the amino acid sequence of any polypeptide as defined in (a); (c) a polypeptide comprising the polypeptide as defined in (a) or (b) as a partial sequence and comprising no region other than the partial sequence of SEQ ID NO: 1; (d) a polypeptide consisting of 10 or more continuous amino acids in a region of positions 1144 to 1161 or 1174 to 1202 of SEQ ID NO: 1; (e) a polypeptide comprising an amino acid sequence having 80% or higher sequence identity to the amino acid sequence of any polypeptide as defined in (d); and (f) a polypeptide comprising the polypeptide as defined in (d) or (e) as a partial sequence and comprising no region other than the partial sequence of SEQ ID NO: 1.
Absstract of: WO2022268724A2
Assays for SARS-CoV-2 are described, together with lesion induced DNA amplification (LIDA)-based methods for amplifying RNA or DNA.
Absstract of: CA3224799A1
Disclosed are methods and systems for detecting SARS-CoV-2 analytes in dried samples, as for example, dried blood spots. For example, disclosed is a method for measuring an analyte of interest in a dried sample comprising: (a) obtaining a dried sample from a subject; (b) extracting the analyte of interest from the dried sample; and (c) detecting the analyte of interest extracted from the dried sample. In certain embodiments, the analyte of interest is an analyte specific to SARS-CoV-2. Also, the method may include a step of determining a cutoff index (COI) indicative of whether the subject has a detectable amount of the analyte of interest and so is defined as positive, or does not contain a detected amount of the analyte of interest and so is defined as negative, or is defined as indeterminate.
Absstract of: WO2022269097A1
This invention relates to siRNA combinations targeting coronavirus (SARS-CoV-2) transcripts and/or host factor transcripts. The invention further relates to siRNA combinations and pharmaceutical compositions comprising said siRNA combinations for use in the treatment and prophylaxis of coronavirus infections, particularly coronavirus disease 2019.
Absstract of: WO2022269003A1
The present invention is directed to a vaccine composition comprising an immunologically effective amount of a modified vaccinia virus Ankara (MVA) vector comprising at least one nucleic acid encoding the spike (S) protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof. The present invention also relates to combination of vaccines and uses thereof.
Absstract of: EP4360629A1
The present invention relates to a therapeutic agent of a lipase inhibitor for a wide spectrum of RNA viral infections in humans and animals. More specifically, the lipase inhibitor can be used as a therapeutic agent for influenza A virus infection, bovine coronavirus infection, porcine epidemic diarrhea coronavirus infection, bovine rotavirus infection, porcine reproductive and respiratory syndrome virus infection, and sapoviral infection and furthermore, can be utilized as a therapeutic agent for various RNA viral infections in humans and animals, such as infections with SARS CoV-1, MERS-CoV, Zika virus, dengue fever virus, and hepatitis A and C viruses.
Absstract of: WO2022271199A1
The containment of accidental or intentional epidemic disease outbreaks of pathogens to which our populations have limited or no immunity has thus become one of the principal public health challenges of our time. Methods for clinical administration of pharmaceutical compounds for prevention and attenuation of the inflammatory response to microbial diseases, particularly to the use of double stranded ribonucleic acids (dsRNA). Polyriboinosinic- polyribocytidylic acid stabilized with polylysine and carboxymethylcellulose (Poly-ICLC) converts a virus into the equivalent of an attenuated live-microbe vaccine specific to that microbe, so that Poly-ICLC significantly diminishes infectivity if administered appropriately following infection.
Absstract of: CA3231809A1
Disclosed is a pharmaceutical composition to prevent transmission of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the pharmaceutical composition comprising: genetically modified bacteria; sequences of small peptides; and pharmaceutical excipients, wherein the genetically modified oral bacteria are modified to translate, produce, and emit the sequences of small peptides which neutralize SARS-CoV-2 against COVID-19, wherein transgenic technology is used to modify the genetically modified oral bacteria to add genes in genetically modified oral bacteria that are transcribed to produce small peptides from the sequences of small peptides so added, wherein the sequences of small peptides show extreme binding and neutralization to SARS-CoV-2 but not to host proteins or processes, and wherein the pharmaceutical excipients aid the oral and/or nasal administration of the pharmaceutical composition.
Absstract of: US11969442B1
Covid-19 binding aerosols are provided. The Covid-19 binding aerosols include Fe3O4 microparticles, at least one organoselenium compound, at least one essential oil, and incense. The Covid-19 binding aerosols may be formulated for use in any product that is capable of emitting aerosols, including but not limited to as air fresheners, as incense, or the like. The Fe3O4 microparticles may have an average size of 5,000 nm-10,000 nm (between 5-10 μm). The Covid-19 binding aerosols are formulated as aerosol compositions having an average size of greater than 60 μm-100 μm to ensure effective binding to virions.
Absstract of: EP3855186A2
The invention relates to a method for determining the immune status of a subject, more specifically whether the subject has been vaccinated with a composition comprising SEQ ID NO1 or a variant thereof which composition triggers the production of antibodies in the subject or had no previous exposure to SARS-CoV-2 or any component of it, comprising the step determining in a sample the presence or absence of an IgA class antibody to SEQ ID NO1, wherein the sample comprises a set of representative antibodies from the subject. The present invention also relates to method for determining whether a subject produces antibodies as a result of administration of a vaccine for distinguishing whether a subject produces antibodies as a result of administration of a vaccine or as a result of a previous corona virus infection, comprising the step detecting in a sample comprising antibodies from said subject the absence or presence of an antibody to SEQ ID NO1 and the absence or presence of an antibody to SEQ ID NO2.
Absstract of: MX2022011892A
The present disclosure is directed to antibodies binding to and neutralizing the coronavirus designated SARS-CoV-2 and methods for use thereof.
Absstract of: MX2022011892A
The present disclosure is directed to antibodies binding to and neutralizing the coronavirus designated SARS-CoV-2 and methods for use thereof.
Absstract of: US2021238261A1
The present invention relates to a monoclonal antibody specifically recognizing a spike protein of MERS coronavirus (MERS-CoV) or a part of the protein, or a functional fragment thereof, wherein the monoclonal antibody, or functional fragment of the monoclonal antibody characterized in that it comprises polypeptide sequence selected from the group consisting of the following polypeptide sequences: a heavy chain comprising a complementarity determining region 1(CDR 1) amino acid sequence consisting of the sequence of SEQ ID NO: 1, a CDR2 consisting of the sequence of SEQ ID NO: 2 and a CDR 3 consisting of the sequence of SEQ ID NO: 3; and a light chain comprising CDR1 amino acid sequence consisting of the sequence of SEQ ID NO: 4, a CDR2 consisting of the sequence of SEQ ID NO: 5 and a CDR 3 consisting of the sequence of SEQ ID NO: 6.and uses thereof.
Absstract of: WO2024086575A1
This disclosure relates to the field of RNA to prevent or treat multiple infectious agents. In particular, the present disclosure relates to methods and agents for vaccination against coronavirus infection, influenza infection, and/or RSV infection and inducing effective coronavirus, influenza virus, and/or RSV antigen-specific immune responses such as antibody and/or T cell responses. Specifically, in one embodiment, the present disclosure relates to methods comprising administering to a subject (i) a bivalent RNA vaccine encoding peptides or proteins comprising epitopes of SARS-CoV-2 spike proteins (S proteins) and (ii) a tetravalent RNA vaccine encoding peptides or proteins comprising epitopes of hemagglutinin (HA), for inducing an immune response against coronavirus S proteins, in particular S proteins of SARS-CoV-2, and influenza proteins, in particular HA proteins of type A and type B influenza viruses, in the subject.
Absstract of: WO2024084397A1
The invention relates to vaccination of human subjects, in particular elderly, against pneumoccocal and COVID-19 infections.
Absstract of: WO2024084400A2
The present disclosure relates generally to alpha 2 macroglobulin (A2M) protein and soluble Klotho (sKL) protein, compositions comprising same, and related uses (e.g., treating a coronavirus (e.g., severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection, treating post-acute sequelae (PASC), treating inflammation, treating bacterial infection, inhibiting an interaction between a SARS-CoV-2 spike protein and an angiotensin-converting enzyme 2 (ACE2) protein, inhibiting a coronavirus (e.g., SARS-CoV-2) papain-like protease (PLpro) protein, rejuvenating skin, and cosmetically treating skin).
Absstract of: WO2024086566A2
Provided herein are antibodies and antigen binding fragments that are capable of binding to a betacoronavirus, e.g. a sarbecovirus selected from one or more of SARS-CoV-2, SARS-CoV-2 omicron, SARS-CoV-2 beta, SARS-CoV-1, WIV-1, RaTG13, and SCH014.
Absstract of: WO2024086777A2
Compositions and methods are provided for inhibiting the replication of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
Absstract of: WO2024086132A1
Described are proteolysis targeting chimeras (PROTACs) for use in managing and treating infectious disease. Described compositions can be used to inhibit viral replication associated with coronavirus, including severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the virus that causes Coronavirus disease 2019 (COVID-19). Methods of synthesizing PROTACs are described. Example PROTAC compositions are provided, including dual targeting compounds having a main protease (Mpro) ligand attached to a linker, an E3 ligase ligand attached to the linker, and a papain-like protease (PLpro) inhibitor attached to the linker. PROTAC compounds useful for degrading Mpro activity and/or PLpro activity, and useful for treating coronavirus infections such as COVID-19, are described.
Absstract of: WO2024085723A1
The present application relates to a protein structure and a use thereof for a vaccine for prevention or treatment of coronavirus SARS-CoV-2 infectious disease, the protein structure comprising: a first recombinant protein having a SARS-CoV-2 spike protein S1-derived protein and a ferritin heavy chain protein connected; and a second recombinant protein having an antibody Fc region protein and a ferritin light chain protein connected.
Absstract of: WO2024085143A1
The purpose of the present invention is to provide a novel peptide that could be used to induce an immune response to SARS-CoV-2. A nucleocapsid-derived antigen peptide according to the present disclosure includes the following polypeptide (P1), (P2) or (P3): (P1) a polypeptide comprising an amino acid sequence represented by SEQ ID NO: 1 (KAYNVTQAF); (P2) a polypeptide comprising an amino acid sequence obtained by deleting, inserting, substituting, or adding 1-6 amino acids in the amino acid sequence represented by SEQ ID NO: 1; and (P3) a polypeptide comprising an amino acid sequence having at least 80% identity to the amino acid sequence represented by SEQ ID NO: 1.
Absstract of: WO2024083117A1
The present invention provides a drug combination comprising Nafamostat and K777 and a use thereof. The pharmaceutical composition comprises active ingredients, i.e., Nafamostat and K777. The pharmaceutical composition of the present invention can show a remarkable synergistic effect in related research on anti-coronavirus, and shows improvement of the effectiveness of more than 10 times in an anti-novel coronavirus test.
Absstract of: WO2024082795A1
The present invention relates to a protein and a vaccine against infections of SARS-CoV-2 Omicron mutant strain XBB and a subtype thereof, which belong to the field of medicines. In order to solve the problem of lack of effective prevention and treatment drugs against infections of the SARS-CoV-2 Omicron mutant strain XBB and the subtype thereof, the protein and the vaccine against the infections of SARS-CoV-2 Omicron mutant strain XBB and the subtype thereof are provided. The vaccine is designed on the basis of the full-length S protein of SARS-CoV-2 Omicron mutant strain XBB and sub-line XBB, the RBD sequence in the S protein, and an optimized sequence thereof. The vaccine can assist the host in resisting coronavirus infection, and in particular has a relatively good prevention and treatment effect with regard to cross infections caused by the SARS-CoV-2 Omicron mutant strain XBB and a subtype virus thereof.
Absstract of: WO2024082067A1
Described herein is a fusion polypeptide comprising a sarbecovirus binding moiety linked to a nanocage monomer or subunit thereof, wherein the sarbecovirus binding moiety is capable of binding to SARS-CoV-2 and at least one sarbecovirus other than SARS-CoV-2. Also described are methods for treating and/or preventing sarbecovirus infection and/or a sarbecovirus-associated condition.
Absstract of: WO2024082003A1
The present invention relates generally to compositions and methods for inhibiting the replication of coronaviruses and treating diseases caused by coronavirus infection. More specifically, the invention provides nucleic acids capable of inhibiting coronavirus (e.g. SARS-CoV-2) replication and their use in treating patients infected by the virus.
Absstract of: ZA202213710B
An anti-SARS-CoV-2 infection protein and vaccine. The protein contains a structural domain bound to an angiotensin converting enzyme 2 receptor in an S protein of SARS-CoV-2. A vaccine for preventing and/or treating the SARS-CoV-2 infection contains the anti-SARS-CoV-2 infection protein, and pharmaceutically acceptable auxiliary materials or auxiliary components.
Absstract of: ZA202213089B
An infectious disease screening system (1) for screening for infectious diseases, such as COVID-19 disease. The system comprises an ultrasonic transducer (49) for generating ultrasonic waves to lyse cells in a biological sample. The system (1) comprises a controller which controls the ultrasonic transducer (49) to oscillate at an optimum frequency for cell lysis, a PCR apparatus (16) which receives and amplifies the DNA from the sample; and a detection apparatus (70) which detects the presence of an infectious disease in the amplified DNA and provides an output which is indicative of whether or not the detection arrangement (70) detects the presence of an infectious disease in the amplified DNA.
Absstract of: GB2623728A
We claim vaccines and a method of making vaccines targeted against diseases caused by viruses, including influenza virus and SARS CoV-2, against cancer, and diseases caused by bacteria, fungi, and other biomaterials/diseases that are combatted with an immune response. The mRNA vaccine is injected into the body whereupon the injected mRNA hijacks the translational machinery of the cells to produce an antigen such as a virus spike protein or surface protein (or part thereof) and stimulates an immune response. The mRNA in the vaccine is a mixture of mRNAs and where at least one or more of the RNAs are undirected mutant variants of the parent mRNA. The vaccine is a poly vaccine and provides protection against multiple variants. The vaccine may comprise mRNA species encoding several random undirected mutations directed against unknown variants.
Absstract of: EP4356924A2
The present disclosure is directed to antibodies binding to and neutralizing the coronavirus designated SARS-CoV-2 and methods for use thereof.
Absstract of: KR20240053097A
본 발명은 면역세포 활성 KP3 펩타이드(GPATCH4P)를 융합시켜서 더 높은 면역원성을 나타내는 면역원을 발굴하였고, 실제 동물실험에서도 중화항체가 더 잘 형성되었음을 확인하였다. 재조합 면역원 접종 후 신종코로나바이러스를 감염하는 면역 후 공격시험에서도 우수한 방어면역을 유도하는 것을 확인하였다. 이러한 우수한 결과를 보여주는 재조합 면역원을 이용하여 치명적인 위험을 나타내는 신종코로나바이러스 변이주에 대한 예방을 위한 백신으로 개발할 수 있을 것이다.
Absstract of: ZA202213894B
A Detoxified recombinant tetanus neurotoxin (DrTeNT) prepared by mutation of the active site amino acid residues is an effective vaccine candidate, and is to be used for embedding epitopes of SARS-CoV-2 vims protein for vaccination against Covid-19. DrTeNT is a risk-free vaccine, free of formalin or any other chemical adjuvants. The gene clone of DrTeNT has been used to insert DNA sequences corresponding to the most suitable epitopes of SAR-CoV-2 vims. The resultant combo vaccine is to have higher efficacy for DrTeNT acts as adjuvant, and higher safety as most of the population preimmunized with tetanus vaccine.
Absstract of: EP4357781A1
The present invention provides an immunoassay method for assaying SARS-CoV-2 in a biological sample, including using two types of monoclonal antibodies or antibody fragments thereof that bind to a peptide fragment having 30 or less consecutive amino acids in a nucleocapsid protein of SARS-CoV-2, wherein the two types of monoclonal antibodies or antibody fragments thereof recognize different epitopes.
Absstract of: EP4357780A1
The present invention provides an immunoassay method for assaying SARS-CoV-2, including a step of contacting a biological sample with a monoclonal antibody or an antibody fragment thereof that binds to a nucleocapsid protein of SARS-CoV-2, wherein the monoclonal antibody or the antibody fragment thereof binds to the SARS-CoV-2 treated with a serine protease.
Absstract of: EP4357368A1
Provided is a recombinant RBD trimer protein capable of simultaneously generating cross neutralization activity aiming at multiple SARS-CoV-2 epidemic strains. The trimer protein is composed of subunits of three novel coronavirus S protein RBD regions, and the amino acid sequences of the three SARS-CoV-2 RBD regions are the same or at least one is different. When the amino acid sequences of the three SARS-CoV-2 RBD regions are the same, the amino acid sequences are the amino acid sequences shown as SEQ ID No.2 or SEQ ID No.3, or sequences having 95% or more of homology with the amino acid sequences shown as SEQ ID No.2 or SEQ ID No.3.
Absstract of: ZA202213088B
A disease screening device (100) comprising a substrate (101) and a sonication chamber (102) formed on the substrate (101). The sonication chamber (102) is provided with an ultrasonic transducer (105) which generates ultrasonic waves to lyse cells in a sample fluid within the sonication chamber (102). The device (100) comprises a reagent chamber (111) formed on the substrate (101) for receiving a liquid PCR reagent. The device (100) comprises a controller (23) which controls the ultrasonic transducer (105) and a heating arrangement (128) which is provided on the substrate (101). The device (100) further comprises a detection apparatus which detects the presence of an infectious disease, such as COVID-19 disease.
Absstract of: CN117580862A
The present disclosure relates to a B lymphocyte stimulator (BlyS; BlyS; BlyS ') for use in the treatment of acute sequelae (PASC) following infection with LongCovid and/or SARS-CoV-2, in the treatment of acute sequelae (PASC) following infection with LongCovid and/or SARS-CoV-2. B cell activating factors; bAFF) antagonists are disclosed. Also disclosed are BlyS antagonists for the treatment of autoimmune disorders induced following viral infection. Such autoimmune conditions may be chronic, such as growing new crowns. Also provided are methods of treating an autoimmune disorder induced following a viral infection, the method comprising administering to a subject in need thereof a therapeutically effective amount of a BlyS antagonist.
Absstract of: KR20240052440A
본 발명은 신경망 모델을 이용하여 COVID-19를 진단하는 것과 관련된 것으로, 흉부 X선 이미지를 분석하여 유형을 분류하고, COVID-19 이미지에 대해서 중증을 평가할 수 있도록 훈련 데이터 셋을 이용하여 신경망 모델을 훈련시키고, 훈련된 신경망 모델을 이용하여 진단 대상의 흉부 X선 이미지를 분석함으로써 유형을 분류하고, COVID-19 이미지에 대해서 중증을 평가하는 것과 관련된다.
Absstract of: WO2024079285A1
The invention relates to pharmaceutical product comprising a polynucleotide for use in the prevention or treatment of a SARS-CoV-2 virus infection wherein said SARS-CoV-2 virus is not a Wuhan wild-type SARS-CoV-2 virus. The polynucleotide encodes an attenuated human coronavirus or a fragment thereof, wherein the polynucleotide comprises at least 20 one-to-stop codons, wherein a one-to-stop codon is i) a different but synonymous codon compared to the corresponding codon in a natural human coronavirus genome and ii) differs by one nucleotide from a STOP codon.
Absstract of: WO2024079492A1
The invention relates to Corynebacterium strains capable of reducing the expression of cathepsin, and their combinations for use in the prevention of a viral infection, in particular SARS-CoV-2 infection, or for use in the prevention of an infection by an enveloped respiratory virus in a subject, wherein said virus uses cathepsin entry route for entry into the cell of the subject. In particular, said virus is SARS-CoV-2 omicron variant. The invention also relates to lyophilized formulations comprising Corynebacterium strains or combinations thereof, and a cryoprotectant, for use in the prevention of an infection by an enveloped respiratory virus, preferably a SARS-CoV-2 virus in a subject. Preferably, the formulation is administered to the upper respiratory tract of the subject.
Absstract of: WO2024081602A2
This invention provides a monoclonal antibody that (i) specifically binds to the extracellular portion of human angiotensin converting enzyme 2 (hACE2); (ii) specifically inhibits binding of SARS-CoV-2 to the extracellular portion of hACE2; and (iii) does not significantly inhibit the ability of hACE2 to cleave angiotensin II and/or a synthetic MCA-based peptide. This invention also provides related recombinant AAV vectors, recombinant AAV particles, compositions, prophylactic and therapeutic methods, and kits.
Absstract of: US2024124419A1
This invention is in the field of medicinal chemistry. In particular, the invention relates to a new class of small-molecules as defined within Formula I (as defined herein) which function as inhibitors of glucose-regulated protein 78 (GRP78) within cancer cells and/or immune cells, and which function as effective therapeutic agents for treating, ameliorating, and preventing various forms of cancer (e.g., pancreatic cancer), viral infections (e.g. SARS-CoV-2), and inflammatory diseases. In addition, this invention also relates to a new class of PROTACs having Formulas II, III and IV (as defined herein) which function as degraders of GRP78 within cancer and/or immune cells. Pharmaceutical compositions comprising said compounds of Formulas I, II, III, or IV are also within the scope of the present invention.
Absstract of: US2024124529A1
Disclosed herein are cross-linked peptides useful for interfering with and inhibiting coronavirus infection (e.g., infection by SARS-CoV-2). Also disclosed are methods of treating and/or preventing a coronavirus infection (e.g., COVID-19).
Absstract of: US2024124558A1
The embodiments of the present disclosure provide an antibody or antigen-binding fragment against SARS-CoV-2 spike(S) protein, comprising: three complementarity determining regions (HCDRs) of a heavy chain variable region or one or more variants thereof, the heavy chain variable region set forth as SEQ ID NO. 30 or SEQ ID NO. 46, each of the one or more variants having at most two amino acid changes compared to the corresponding CDR; and three complementarity determining regions (LCDRs) of a light chain variable region or one or more variants thereof, the light chain variable region set forth as SEQ ID NO. 32 or SEQ ID NO. 48, each of the one or more variants having at most two amino acid changes compared to the corresponding CDR.
Absstract of: US2024124395A1
Inhibitors of SARS-COV-2 (COVID), pharmaceutical compositions comprising same; and methods of treating a severe acute respiratory syndrome.
Absstract of: WO2024081269A1
The disclosure relates in some aspects to methods of treating a subject having post-acute sequelae of COVID-19 (PASC), sometimes also known as "long COVID." Also provided are pharmaceutical combinations for treating a subject having PASC, such as using one or more antiviral agents and one or more antibodies, as well as kits used with disclosed pharmaceutical combinations and in disclosed methods.
Absstract of: WO2024080289A1
The present invention addresses the problem of providing a preventive measure against human coronavirus infection other than handwashing and gargling. Fermented milk according to the present invention is prepared using lactic acid bacteria that produce exopolysaccharides, and functions to increase IgA that cross-binds with human coronavirus in human saliva. The lactic acid bacteria are preferably of the family Lactobacillaceae, more preferably of the genus Lactobacillus, and even more preferably are Lactobacillus delbrueckii subsp. bulgaricus, in particular Lactobacillus delbrueckii subsp. bulgaricus OLL1073R-1 (FERM BP-10741).
Absstract of: WO2024078312A1
The use of a sulfonated polysaccharide. The sulfonated polysaccharide has a strong capability of inhibiting SARS-CoV-2 from infecting host cells, and therefore can be used for preparing drugs for treating and/or preventing corona virus disease 2019.
Absstract of: AU2022367398A1
This invention provides a monoclonal antibody that (i) specifically binds to the extracellular portion of human angiotensin converting enzyme 2 (hACE2); (ii) specifically inhibits binding of SARS-CoV-2 to the extracellular portion of hACE2; and (iii) does not significantly inhibit the ability of hACE2 to cleave angiotensin II and/or a synthetic MCA-based peptide. This invention also provides related recombinant AAV vectors, recombinant AAV particles, compositions, prophylactic and therapeutic methods, and kits.
Absstract of: US2024123356A1
The need for increased human interaction beyond traditional social activities is increasing especially in the post-Covid-19 era. Social networks can assist individuals in creating connections and interacting with other people. However, it is often difficult for individuals with specific interests in emerging competitive activities to find other people with similar interests on traditional social networks. As discussed in more detail below, the present disclosure relates to creating a social network for individuals sharing common interests in a variety of competitive activities. The benefit of this approach is that it creates a dedicated social network where a like-minded community can be formed to connect players from around the world to participate in friendly competition.
Absstract of: US2024123029A1
The present invention relates to a molecule for use in the treatment and/or prevention of viral infections caused by highly pathogenic coronaviruses, including Severe Acute Respiratory syndrome Coronavirus 2 (SARS-COV-2), or variants thereof, Severe Acute Respiratory syndrome Coronavirus ((SARS)-COV) and sarbecoviruses, said molecule being a mannose binding lectin (MBL) polypeptide, or a functional fragment, derivative, mutein or variant thereof, or an homologue having a percentage of identity with MBL polypeptide of at least 50, 60, 70, 80 or 90%, preferably for use in the treatment and/or prevention of 2019 Coronavirus disease (COVID-19).
Absstract of: US2024122931A1
The invention features methods of treating a SARS-CoV-2 infection in a subject, the method comprising administering to the subject an effective amount of sepiapterin or a pharmaceutically acceptable salt thereof.
Absstract of: US2024122916A1
A preparation comprising the YEL002 compound as an active ingredient for the prevention or treatment of one or more diseases, and methods of using such preparations. The preparations may be a sublingual pill, an injection, dissolved in liquid, dissolved in oil, or any other preparation. The conditions or diseases indicated may be poisoning, radiation poisoning, chemotherapy poisoning, poor vision, peripheral artery disease, smoker's leg, diabetic feet, periodontal disease, varicose or spider veins, blood clots, COVID-19, long COVID, liver disease, symptoms caused by chemotherapy or radiation therapy, hair loss, cancer, inflammation-caused or inflammation-related diseases, autoimmune diseases, infections, and headaches including migraines.
Absstract of: US2024122934A1
Compositions and methods of treatment for inhibiting capillary tube regression and/or lymphatic tube regression are described, as well as factors and signaling pathways that control the regression of capillary tube networks. Capillary tube regression and/or lymphatic tube regression may be implicated in ischemia, infarction, hypertension, diabetes, malignant cancer, neurodegenerative disease, wound repair response, atherosclerosis, pro-inflammatory disease, pro-thrombotic disease, viral infection (e.g., influenza or SARS-CoV-2), bacterial infection.
Absstract of: US2024123023A1
The disclosure at hand concerns a pharmaceutical composition comprising Angioten-sin-(1-7) (Asp-Arg-Val-Tyr-Ile-His-Pro) for use in the treatment of coronavirus infection related diseases, wherein Angiotensin-(1-7) is administered in a formulation selected from the group consisting of intramuscular, transdermal, pulmonary, lingual, buccal, nasal or a combination of at least two members of said list. Furthermore, the disclosure relates to a pharmaceutical composition comprising Angiotensin-(1-7) in a pharmaceutical acceptable carrier.
Absstract of: US2024123056A1
Disclosed herein is a vaccine comprising a Middle East Respiratory Syndrome coronavirus (MERS-CoV) antigen. The antigen can be a consensus antigen. The consensus antigen can be a consensus spike antigen. Also disclosed herein is a method of treating a subject in need thereof, by administering the vaccine to the subject.
Absstract of: US2024123054A1
Provided are highly conserved antigens and epitopes of SARS-CoV-2 that can be used in vaccines and to produce bindings proteins (e.g., antibodies) for treating, preventing, or reducing the risks of infections caused by β-coronaviruses such as SARS-CoV-2, and as targets for detecting SARS-CoV-2 infection
Absstract of: US2024123053A1
The invention generally discloses coronavirus vaccine for coronavirus disease. Particularly, the invention discloses coronavirus vaccine through nasal immunization. More particularly, the invention describes and develop a preventive vaccine against infection or disease caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) through nasal immunization in mammals. Specifically, the invention describes human adenovirus which is engineered to express SARS-CoV-2 spike protein or part/fragment thereof which elicit immune response against the SARS-CoV-2 in mammals, and it is also suitable for immunizing human subjects. Describes the method of production of novel adenovirus vectors, use thereof in vaccine composition, vaccine formulation, preparation, and method of treatment of COVID-19 using above said novel vectors and compositions thereof.
Absstract of: US2024124917A1
Rapid, sensitive, and specific point-of-care testing for pathogens is crucial for disease control. Lateral flow assays (LFAs) have been employed for nucleic acid detection, but they have limited sensitivity and specificity. A fusion of catalytically inactive Cas9 endonuclease and a relaxase for example, VirD2 are used for sensitive, specific nucleic acid detection by LFA. VirD2-dCas9 specifically binds the target nucleic acid sequence via dCas9 and covalently binds to a FAM-tagged oligonucleotide via VirD2. The biotin label and FAM tag are detected using a LFA. This system, termed Vigilant (VirD2-dCas9 guided and LFA-coupled nucleic acid test) is coupled to reverse transcription-recombinase polymerase amplification to detect pathogenic nucleic acid of interest in a sample, it exhibits an impressive limit of detection and shows no cross-reactivity, thus reducing incidents of false positives. Vigilant offers an easy-to-use, rapid, cost-effective, and robust detection platform for SARS-CoV2.
Absstract of: US2024124947A1
Sequences for detection of SARS-CoV-2 are provided and include example, SEQ ID NOs:4-8. The sequences are useful for amplifying the SARS-CoV-2 nsp8 gene in a sample, using Reverse Transcriptional Loop-Mediated Isothermal Amplification (RT-LAMP) and it is preferably used in combination with a Cas enzyme/sgRNA pair and a reporter nucleic acid.The disclosed sequences can be use in methods of detecting SARS-CoV-2 nucleic acids in a sample. Generally, the specific gene sequence of SARS-CoV-2 RNA, herein nsp8, is amplified using RT-LAMP. The RT-LAMP products are scanned by the Cas12a-gRNA ribonucleoprotein (RNP) complex. The RNP binds to the specific complementary to gRNA, activating the transcleavage activity of Cas12a. The active Cas12a system cleaves a short ssDNA reporter that is labeled preferably, with a fluorophore and a quencher on either end. Cleavage of the reporter separates the quencher from the fluorophore, and fluorescence that is detectable with the naked eye is generated.
Absstract of: US2024108681A1
Coronavirus Disease 2019 (COVID-19) remains a threat with the emergence of new variants, especially Delta and Omicron, without specific effective therapeutic drugs. The present invention provides a method and a composition for preventing and treating COVID-19 (SARS-CoV-2) coronavirus infection which includes administering to a subject in need thereof one or more therapeutically effective doses of Virofree which comprises a pharmaceutically acceptable combination of grape seed extract, acerola cherry extract, olive leaf extract, marigold extract, green tea extract, pomegranate extract, yeast beta-glucan and soya bean extract for a treatment period.
Absstract of: CA3221441A1
A pharmaceutical formulation is provided that includes a 2019 novel coronavirus (2019-nCoV) antibody and agents that provide commercially acceptable shelf-life stability, in-use stability and acceptable patient injection site experience. Such formulations can be used for attenuating, preventing and/or treating 2019-nCoV infection or COVID-19.
Absstract of: WO2022258847A1
The present invention relates to a highly sensitive method for the screening of COVID-19 based on the use of selected symptoms and a simple olfactory test requiring the identification of a scent. It further relates to a data processing device and computer program related thereto.
Absstract of: MX2022011892A
The present disclosure is directed to antibodies binding to and neutralizing the coronavirus designated SARS-CoV-2 and methods for use thereof.
Absstract of: US2024115589A1
ProblemCOVID-19 caused by coronavirus SARS-CoV-2, cytokine release syndrome, cytokine release syndrome with CAR (chimeric antigen receptor)-T therapy, sepsis, systemic inflammatory response syndrome, hemophagocytic syndrome, macrophage activation syndrome, influenza, GVHD, systemic vasculitis, Kawasaki disease, Takayasu arteritis, and other diseases, if severe, can cause acute respiratory distress syndrome, disseminated intravascular coagulation syndrome, acute circulatory insufficiency, multi-organ failure, and other symptoms which are one of the causes of death.Solution to ProblemCompounds represented by formulas (1) to (4) are effective when taken orally and can be expressed in smaller amounts than mangiferin.
Absstract of: US2024115590A1
Embodiments of therapeutic protocols to treat Post-Acute Sequelae SARS-CoV-2 infection (“PASC”), a.k.a. “long Covid,” are described. The PASC treatment protocols focus on a moderating a hyperimmune response; destroying and removing the SARS CoV-2 spike protein from the gut and body, detoxifying the body and the brain; replenishing key nutrients; mitigating depression and anxiety; and a regimen of physical and mental exercises. A standard six-week protocol and a shorter, three-week protocol are disclosed for those with a milder form of PASC are disclosed.
Absstract of: US2024115596A1
The present disclosure provides small hairpin nucleic acid molecules capable of stimulating interferon production. The nucleic acid molecules of the present disclosure has a double-stranded section of less than 19 base pairs and at least one blunt end. In certain embodiments, the molecule comprises at least one 5′-triphosphate and/or at least one 5′-diphosphate. In certain embodiments, compounds and/or compositions of the disclosure are useful for treating, ameliorating, and/or preventing SARS-CoV-2 viral infection, and/or ameliorating, minimizing, reversing, and/or preventing persistent SARS-CoV-2 viral infection, and/or minimizing or preventing SARS-CoV-2 viral infection-derived mortality and/or lethality, in a subject. In certain embodiments, compounds and/or compositions of the disclosure are useful for treating, ameliorating, and/or preventing SARS-CoV-2 viral infection in a tumor-bearing subject. In certain embodiments, compounds and/or compositions of the disclosure are useful for treating, ameliorating, and/or preventing SARS-CoV-2 viral infection in an immune-compromised and/or immunodeficient subject.
Absstract of: US2024115567A1
The present invention relates to molecules represented with Formula (I), Formula (II), and Formula (III) and the use of these molecules in the treatment of SARS-CoV-2.
Absstract of: US2024115512A1
The present invention relates to a simple and convenient process for preparing solid lipid sustained release nanoparticles for berbamine delivery. The process involves preparation of nanoparticles by maintaining the pH of the aqueous or lipid phase so that high drug loading of 12-50% w/w with respect to the lipid matrix and high entrapment efficiency of more than 90% for berbamine in the solid lipid nanoparticles is achieved. The nanoformulation obtained by the process of the present invention has increased efficacy and exhibited any therapeutic property identical to free berbamine such as antiviral-cum-antibacterial agent for the treatment of microbial infections especially resistant Acinetobacter infections in treating diabetes and more specifically diabetes associated complications. Use may be extended to other diseases like COVID 19.
Absstract of: US2024115157A1
Methods and devices for analyzing non-volatile organics in exhaled breath and other aerosols using various diagnostic tools that enable rapid, low-cost point of care assays for several diseases including respiratory tract diseases such as COVID-19. The disclosed methods and systems selectively capture non-volatile organics in exhaled breath and other aerosols in a packed bed column. The non-volatile organics are eluted and samples are analysis using diagnostic devices including MALDI-TOFMS. The disclosed systems and methods provide for a diagnostic test result in less than about 20 minutes and provides for autonomous operation with minimal human intervention.
Absstract of: US2024115695A1
The invention relates to biotechnology, and specifically to a method for creating the adjuvant betulin, suitable for preparing a vaccine against coronavirus SARS-CoV-2. The method consists in sterilizing filtration of a solution of betulin in tetrahydrofuran through a nylon membrane with a pore diameter of 0.22 μm, decreasing the tetrahydrofuran content by adding a 25-fold volume of sterile 0.01 M tris-buffer (pH 9.0+0.1), and subsequently homogenizing by ultrasound until a homogeneous suspension results, forming spherical amorphous homogeneous particles suitable for binding proteins of the SARS-CoV-2 virus. The proposed technique makes it possible to produce betulin with high sterility and immunogenicity, which improves the quality of the vaccine against the coronavirus.
Absstract of: US2024115693A1
Provided herein are nanoparticles which enhance the immunogenicity of antigens for use in Beta coronavirus (e.g., MERS-CoV, SARS-CoV-1, or SARS-CoV-2) vaccines, as well as immunogenic compositions comprising the antigen nanoparticles and additional adjuvants for further enhancing immunogenicity.
Absstract of: US2024115667A1
Compositions and formulations comprising diphenhydramine and lactoferrin for preventing or treating infection by a SARS-CoV-related betacoronavirus are described. Methods of using the compositions and formulations are also described. The methods include administering to a patient at risk of being infected by a SARS-CoV-related betacoronavirus or suffering from SARS-CoV-related betacoronavirus-related illness a composition or formulation comprising diphenhydramine and lactoferrin.
Absstract of: US2024117011A1
Disclosed are monoclonal antibodies, antigen binding fragments, and bi-specific antibodies that specifically bind a coronavirus spike protein, such as SARS-CoV-2. Also disclosed is the use of these antibodies for inhibiting a coronavirus infection, such as a SARS-CoV-2 infection. In addition, disclosed are methods for detecting a coronavirus, such as SARS-CoV-2, in a biological sample, using the disclosed antibodies.
Absstract of: US2024116865A1
Inhibitors of SARS-CoV-2 (COVID), pharmaceutical compositions comprising same; and methods of treating a severe acute respiratory syndrome.
Absstract of: US2024117012A1
Provided is an antibody that binds to the N-protein of SARS-CoV-2, and a method for utilizing the antibody. An antibody that binds to SARS-CoV-2, having one or more structural domains comprising CDRs shown in the following (a) or (b): (a) CDR1 consisting of the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence obtained by substituting one amino acid with another amino acid in the amino acid sequence, CDR2 consisting of the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence obtained by substituting one amino acid with another amino acid in the amino acid sequence, and CDR3 consisting of the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence obtained by substituting one amino acid with another amino acid in the amino acid sequence; or (b) CDR1 consisting of the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence obtained by substituting one amino acid with another amino acid in the amino acid sequence, CDR2 consisting of the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence obtained by substituting one amino acid with another amino acid in the amino acid sequence, and CDR3 consisting of the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence obtained by substituting one amino acid with another amino acid in the amino acid sequence.
Absstract of: US2024117010A1
The present invention relates to novel proteins that specifically bind to the spike protein or domains thereof of the severe acute respiratory syndrome corona virus 2 (SARS-Cov-2) or variants of SARS-Cov-2. The proteins of the present invention represent advanced and powerful tools, for example for the purification of the virus or a vaccine for the virus, by virtue of said binding affinity for spike protein or domains of the spike protein of SARS-Cov-2 or variants thereof. Thus, the novel proteins of the present invention are particularly advantageous because they allow precise capturing of proteins or particles comprising spike proteins, S1 domain, and/or RBD in affinity chromatography. Further, the novel proteins of the present invention can be used in medical applications caused by or related to SARS-Cov-2 or variants thereof.
Absstract of: US2024116972A1
The present disclosure is concerned with 6-aza-nucleoside prodrugs that are capable of inhibiting a viral infection and methods of treating viral infections such as, for example, human immunodeficiency virus (HIV), human papillomavirus (HPV), chicken pox, infectious mononucleosis, mumps, measles, rubella, shingles, ebola, viral gastroenteritis, viral hepatitis, viral meningitis, human metapneumovirus, human parainfluenza virus type 1, parainfluenza virus type 2, parainfluenza virus type 3, respiratory syncytial virus, viral pneumonia, yellow fever virus, tick-borne encephalitis virus, Chikungunya virus (CHIKV), Venezuelan equine encephalitis (VEEV), Eastern equine encephalitis (EEEV), Western equine encephalitis (WEEV), dengue (DENV), influenza, West Nile virus (WNV), zika (ZIKV), Middle East Respiratory Syndromes (MERS), Severe Acute Respiratory Syndrome (SARS), and coronavirus disease 2019 (COVID-19), using these compounds. This abstract is intended as a scanning tool for purposes of searching in the particular art and is not intended to be limiting of the present invention.
Absstract of: US2024116946A1
The present disclosure relates to compounds of Formula I:and pharmaceutically acceptable salts thereof, pharmaceutical compositions thereof, useful in the treatment of treating viral infections, for example, coronaviridae infections.
Absstract of: WO2024074849A1
Compounds of formula (I) are disclosed: or a salt, solvate or tautomer thereof, wherein; PLL comprises a SARS-CoV-2 papain-like protease ligand, X comprises a divalent exit vector; X1 comprises a divalent exit vector; a and b are independently selected from 1 or 2; L comprises a divalent linker, and UL comprises an E3 ubiquitin ligase ligand. Also disclosed are pharmaceutical compositions comprising such compounds or combinations, and methods and reagents using the compounds. Compounds may have therapeutic uses and uses in research.
Absstract of: WO2024074848A1
Compounds of formula (I) are disclosed: or a salt, solvate or tautomer thereof, wherein; MPL comprises a SARS-CoV-2 main protease ligand, X comprises a divalent exit vector; Xi comprises a divalent exit vector; a and b are independently selected from 1 or 2; L comprises a divalent linker, and UL comprises an E3 ubiquitin ligase ligand. Also disclosed are pharmaceutical compositions comprising such compounds or combinations, and methods and reagents using the compounds. Compounds may have therapeutic uses and uses in research.
Absstract of: WO2024074651A1
This application relates to novel compounds and their use as SARS-CoV-2 Main Protease (Mpro) inhibitors. Compounds described herein may be useful in the treatment of SARS-CoV-2 and related viruses and disorders associated with SARS-CoV-2: Mpro. The application is also directed to pharmaceutical compositions comprising these compounds and the manufacture and use of these compounds and compositions in the treatment of SARS-CoV-2 and related viruses and disorders associated with SARS-CoV-2: Mpro. The compounds and compositions may be useful in preventing death or complications arising due to chronic underlying conditions or comorbidities in patients infected with SARS- CoV-2 and related viruses.
Absstract of: WO2024076285A1
The present invention relates to a peptide consisting of 50 amino acid residues or less and comprising the motif XG(F/L/A/V/I/M/W/C)X(L/I/V)(G/D/P) (SEQ ID NO: 1), wherein X at position (4) is independently any amino acid and X at position (1) is independently any amino acid but not Arg, wherein the peptide is a coronaviral non-structural protein (9) binding peptide.
Absstract of: AU2022241604A1
Abstract of the Disclosure A method for treating patients with COVID-19 and/or other respiratory conditions includes administering eighty-five milligrams of dapsone twice daily for twenty-one days. A variety of dapsone formulations and delivery devices are disclosed, including an inhaler, nasal spray, nasal gel, otic formulation, intravenous formulation, oral solution, oral suspension, patch and suppository.
Absstract of: AU2022349251A1
The disclosure provides compositions, methods of treatment, and methods of making and using compositions to deliver a nucleic acid to a subject. Compositions described herein include lipid carriers, optionally including an inorganic particle, capable of admixing with nucleic acids. Methods of using the compositions as a COVID-19 vaccine for the treatment of a coronavirus infection are also provided.
Absstract of: WO2024077310A1
A preparation comprising the YEL002 compound as an active ingredient for the prevention or treatment of one or more diseases or conditions, and methods of using such preparations. The preparations may be a sublingual pill, an injection, spray, dissolved in liquid, or dissolved in oil. The conditions or diseases indicated may be cancer, chemotherapy and radiation therapy poisoning, allergies, garlic, coffee, gluten allergy, infections, COVID-19, long COVID, flu, tape worms, inflammation-caused or inflammation-related diseases, diabetes, ulcerative colitis, chronic obstructive pulmonary disease, asthma, autoimmune diseases, multiple sclerosis, sore muscles, increased stamina and fitness, headaches including migraines, periodontal disease, varicose or spider veins, blood clots, liver disease, peripheral artery disease, smoker's leg, diabetic feet, and hair loss. Benefits may be anabolism, accelerated muscle growth, and improvements in bowel movement.
Absstract of: WO2024077288A1
The present invention relates to immunogenic compositions against severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), especially to immunogenic compositions having recombinant SARS-CoV-2 S proteins derived from Omicron subvariants.
Absstract of: WO2024076951A2
The application provides compounds of Formula (I) as further defined herein, pharmaceutical compositions comprising said compounds, and methods of using said compounds and compositions for the treatment and/or prevention of various viral infections, including SARS-CoV-2 infections.
Absstract of: WO2024076680A1
The present invention features crystalline forms of Compound I, including polymorphs and pseudopolymorphs, which are useful in the preparation of pharmaceutical compositions.
Absstract of: WO2024076441A2
Due to the precautions put in place during the COVID-19 pandemic, utilization of telemedicine has increased quickly for patient care and clinical trials. Unfortunately, teleconsultation is closer to a video conference than a medical consultation with the current solutions setting the patient and doctor into a discussion that relies entirely on a two-dimensional view of each other. A telehealth platform is augmented by a digital twin of the patient that assists with diagnostic testing of ocular manifestations of myasthenia gravis. A hybrid algorithm combines deep learning with computer vision to give quantitative metrics of ptosis and ocular muscle fatigue leading to eyelid droop and diplopia. The system works both on a fixed image and video in real time allowing capture of the dynamic muscular weakness during the examination. The robustness of the system can be more important that the accuracy obtained in controlled conditions, so that the system and method can operate in practical standard telehealth conditions. The approach is general and can be applied to many disorders of ocular motility and ptosis.
Absstract of: WO2024073848A1
The present disclosure relates to pharmaceutical compositions and methods for the preparation, manufacture and therapeutic use of nucleic acid vaccines comprising lipid nanoparticles (LNP) wherein the LNPs comprise cationic lipids, non-cationic lipids, sterols and conjugated lipids, wherein said LNPs comprise polynucleotide sequences set forth in SEQ ID NOS:7, 20, 26, 27 or 32 encoding one or more structural proteins of SARS-CoV-2 set forth in SEQ ID NO:2 and variants for the treatment, mitigation, amelioration and/or prevention of COVID-19.
Absstract of: US2024115622A1
A novel formulation for the prevention and treatment of COVID-19 is disclosed, featuring the antiviral properties of xylitol and bee propolis. These natural compounds were tested against porcine coronavirus (PEDV), human OC43 virus, and SARS-CoV-2. Notably, propolis and xylitol showed protective effects at concentrations below cytotoxic levels. The formulation is presented as a dental product with propolis (0.25-2.00 wt. %) and xylitol (0.25-3.0 wt. %) alongside various agents for oral and nasal applications. These findings suggest a promising approach to combat coronaviruses and provide an inventive solution for COVID-19 prevention and treatment.
Absstract of: US2024115588A1
Oral formulations comprising one or more proteasome inhibitors for use as a treatment of coronavirus infection in a subject. Also disclosed are the use of such for the treatment or prevention of SARS-CoV-2 infection in humans.
Absstract of: WO2022255895A1
A portable hyperbaric oxygen (PHBO) hood system includes a main hood, a neck sleeve configured to be disposed below the main hood, a pump system configured to control a pressure in the main hood to create hyperbaric environment in the PHBO hood system, and an intelligent controller. The pump system includes a pump and a flow line configured to supply oxygen to the main hood via the pump. The intelligent controller is configured to receive an oxygen saturation value of a patient, receive an oxygen concentration value of the flow line, determine a target pressure of the main hood based on the oxygen saturation value and the oxygen concentration value, and control the pump system to change the pressure of the main hood to the target pressure.
Absstract of: EP4349860A1
The present invention refers to antibodies or antigen-binding fragments thereof that bind the SARS-CoV-2 spike protein with high affinity and subsequent high neutralizing activity against SARS-CoV-2. It also discloses polynucleotides and expression vectors encoding said antibodies or antigen-binding fragments, and host cells comprising said nucleotides and vectors, as well as their use in treatment or prevention of a disease caused by a SARS-CoV-2.
Absstract of: WO2022254363A1
The present invention relates to a high dose/ low volume formulation of lidocaine, or a salt thereof, or articaine, or a salt thereof, for use in the treatment of COVID-19 or an autoimmune disease or a condition in which an immune response caused by a disease or infection causes a cytokine storm. More particularly it relates to the treatment of long-covid and addresses the challenge of getting an effective dose of lidocaine or articaine into the plasma, to treat the systemic inflammation, without causing toxicity.
Absstract of: CA3215879A1
A novel formulation for the prevention and treatment of COVID-19 is disclosed, featuring the antiviral properties of xylitol and bee propolis. These natural compounds were tested against porcine coronavirus (PEDV), human 0C43 virus, and SARS-CoV-2. Notably, propolis and xylitol showed protective effects at concentrations below cytotoxic levels. The formulation is presented as a dental product with propolis (0.25-2.00 wt.%) and xylitol (0.25-3.0 wt.%) alongside various agents for oral and nasal applications. These findings suggest a promising approach to combat coronaviruses and provide an inventive solution for COVID-19 prevention and treatment.
Absstract of: WO2024073730A2
Aspects of the present disclosure are directed to methods and systems for sample collection, tRNA sequencing, and diagnosis, prognosis, and treatment of viral infections such as SARS-CoV-2. Disclosed herein are methods for tRNA sequencing and analysis, including obtaining a tRNA profile of RNA from a nasopharyngeal sample. A tRNA profile may include abundance, fragmentation, and/or modification information for a plurality of tRNAs from a sample. Also disclosed are methods for diagnosis, prognosis, and/or treatment of a viral infection (e.g., SARS-CoV-2 infection) based on abundance, fragmentation, and/or modification information for one or more tRNAs from a subject having or suspected of having a viral infection.
Absstract of: WO2024072870A1
Quinoline compounds are disclosed that have a formula represented by the following: and wherein Cy, R1, R4a, R4b, and n are as described herein. The compounds may be prepared as compositions, e g., pharmaceutical compositions, or as dosage forms, e.g., pharmaceutical dosage forms, and may be used for the prevention and treatment of a variety of conditions in mammals including humans, including by way of non-limiting example, diabetes complications, inflammation, and neurodegeneration, obesity, cancer, ischemia/reperfusion injury, cardiovascular disease, COVID- 19 complications, and other diseases related to RAGE activity.
Absstract of: WO2024067861A1
Provided herein are therapeutic nucleic acid molecules for managing, preventing and/or treating infectious diseases caused by coronavirus. Also provided herein are therapeutic compositions, including vaccines and lipid nanoparticles, comprising the therapeutic nucleic acids and related therapeutic methods and uses. Particularly, provided herein are mRNA vaccines based on sequences derived from SARS-CoV-2 delta and omicron strains.
Absstract of: WO2024066083A1
The present invention relates to the technical field of biology, and in particular to a constant-temperature detection kit and detection method for detecting pathogens. The kit comprises an amplification system; the amplification system comprises a primer set; and the primer set is any one of an African swine fever virus primer set, a porcine circovirus primer set, a pseudorabies virus primer set or a porcine parvovirus primer set, and a SARS-CoV-2 primer set. According to the detection method, lyophilized beads of a virus amplification system are loaded in a micro-fluidic chip reaction tank, the lyophilized beads containing amplification detection components for viruses; and visual endpoint qualitative detection is performed on pathogens by means of H+ ions generated in an amplification process.
Absstract of: WO2024065059A1
A method of diagnosing long-COVID-19 in a patient, the method comprising: (a) obtaining a test sample from the patient, (b) performing one or more assays configured to detect a level of one or more biomarkers in the test sample, (c) comparing the level of the one or more proteins in the test sample with a healthy control reference value of said one or more proteins, wherein a change in the level of the one or more biomarkers in the test sample relative to the healthy control reference value of said one or more proteins is indicative of long-COVID-19 diagnosis, wherein the one or more proteins are selected from Table 3.
Absstract of: US2024108681A1
Coronavirus Disease 2019 (COVID-19) remains a threat with the emergence of new variants, especially Delta and Omicron, without specific effective therapeutic drugs. The present invention provides a method and a composition for preventing and treating COVID-19 (SARS-CoV-2) coronavirus infection which includes administering to a subject in need thereof one or more therapeutically effective doses of Virofree which comprises a pharmaceutically acceptable combination of grape seed extract, acerola cherry extract, olive leaf extract, marigold extract, green tea extract, pomegranate extract, yeast beta-glucan and soya bean extract for a treatment period.
Absstract of: US2024108717A1
Recombinant SARS-CoV2 vaccine compositions and methods are presented that have unexpected cross-reactivity against a variety of other coronaviruses, and particularly against SARS-CoV1, MERS-CoV, OC43-CoV, and HKU1-CoV in addition to significant reactivity against SARS-CoV2A. Moreover, the vaccine compositions presented herein also produced cross-reactive memory B cells as well as cross-reactive memory T cells with cross-reactivity spanning a relatively wide range of different coronaviruses.
Absstract of: US2024108871A1
The present invention provides microneedle delivery adapter devices, and methods of administering compositions using the devices, including methods for generating an immune response in a subject, comprising administering to the subject's skin an immunizing composition from a SARS-CoV-2 pathogen.
Absstract of: WO2024069527A1
Phage for the specific capture of the SARS-CoV-2 virus, said phage being an M13 phage engineered to display on the P8 protein of its coat either FHKGGYEKTWKLGD sequence peptides or EFTSKAR sequence peptides, said peptides having speci fic af finity for the Spike S I protein of the SARS-CoV-2 virus.
Absstract of: WO2024068996A1
The disclosure provides antibodies, or antigen-binding fragments thereof, and use thereof in prophylaxis, treatment and/or attenuation of a SARS-CoV-2 virus infection.
Absstract of: WO2024068777A1
The present invention relates to therapeutic proteins and medical uses thereof. The present invention relates to modified ACE2 protein having increased binding affinity for the SARS- CoV-2 spike protein compared to wildtype ACE2 protein, wherein said modified ACE2 protein is lacking enzymatic activity and is fused to (i) a modified Fc domain of human immunoglobulin, wherein the Fc domain has either enhanced immunostimulating activity (Fc+) or attenuated immunostimulating activity (Fc-) or (ii) a protein that specifically binds to T cells or further enhances immunostimulating activity. The invention also relates to a polynucleotide encoding the modified ACE2 protein of the present invention, a vector or expression construct comprising the polynucleotide, a host cell comprising the polynucleotide or the vector or expression construct, and a non-human transgenic organism comprising the polynucleotide or the vector or expression construct. Moreover, the present invention relates also to a method for the manufacture of a modified ACE protein according to the present invention and to a medicament comprising the modified ACE2 protein, the polynucleotide or the vector or expression construct of the invention. Furthermore, the invention relates to medical uses of the modified ACE2 protein, the polynucleotide or the vector or expression construct in treating and/or preventing a disease or disorder associated with SARS-CoV-2 infection. Finally, the invention provides a kit comprising th
Absstract of: WO2024068265A2
The present invention relates to the use of vaccines comprising virus-like particles displaying at least one SARS-CoV-2 antigen, such as the receptor-binding domain (RBD) of the SARS-CoV-2 spike protein, as vaccine boosters. Antigens are displayed on virus-like particles (VLPs) and produce an immune response in vaccinated subjects. The invention also relates to methods of treatment using the recombinant VLPs as boosters to treat and/or prevent infection with SARS-CoV-2, and methods of preparation thereof.
Absstract of: WO2024073568A2
Described herein is evolution strategy that leverages highly efficient tRNA charging chemistry for cell-free ribosomal translation of proteins, including fluorogenic sensors. The fluorogenic sensors provided are capable of detecting targets, including antigens such as SARS-CoV-2 variants (e.g., Omicron variants).
Absstract of: WO2024073552A2
The present disclosure relates to compositions and methods for vaccinating a subject against multiple SARS-CoV-2 variants and other respiratory viruses that involves the making and delivery of extracellular vesicles expressing on their surface engineered spike protein, engineered nucleocapsid protein, engineered hemagglutinin protein, and/or engineered respiratory syncytial virus prefusion or fusion (RSV F) protein to the subject. The present invention also relates to compositions and methods for the design, preparation, manufacture, formulation, and/or use of spike-display, nucleocapsid-display, hemagglutinin-display, and/or RSV F-display vesicular vaccines designed to elicit strong humoral and cellular immune responses against multiple respiratory viruses and variants.
Absstract of: WO2024073005A2
The present disclosure provides methods of producing engineered exosomes and exosome-based vaccines for SARS-CoV-2 and variants thereof. In one aspect, the disclosure provides an expression vector comprising a nucleic acid sequence encoding a selectable marker protein, and a protein of interest wherein the nucleic acid is operably linked to an expression control sequence and wherein the protein of interest is a SARS-CoV-2 spike (S) protein or variant thereof.
Absstract of: AU2022235561A1
Abstract: HUNG THANH PHAN COVID-19 NEW SOLUTION is the new Machine for new prevention and new treatment of COVID-19 including all kind of virus causing COVID-19 Pandemic, Flue Pandemic, and small bacteria mix in the air. Many people around the world infected by COVID-19 more than 0.6 billion cases and more than 6.5 million people already died due to COVID-19 and about half million people died per year by Flue, in this new solution I introduce the new machine for new prevention and new treatment of COVID-19 virus or any kind of virus and small bacteria mix in the air. This machine for using at homes, hospitals, schools, universities, shops, companies at work, age care, child care, crew ships, air planes, suitable for 7.96 billion people around the world to use.
Absstract of: US2024108715A1
The present invention relates to Coronavirus 2019-nCOV spike protein, polynucleotides encoding said spike protein, antibodies and vaccines for treatment or prevention of 2019-nCOV infection.
Absstract of: US2024109859A1
The invention relates to antiviral compounds, compositions comprising antiviral compounds, and methods of use. In particular, the antiviral compounds are cytidine triphosphate synthetase 1 (CTPS1) inhibitors that are effective in treating and/or preventing viral infection and in particular, SARS-CoV-2 infection and/or COVID-19 disease.
Absstract of: US2024108702A1
Methods for treating and/or SARS-CoV-2 infection are described that inhibit viral replication, multiple protease activities, and provide anti-inflammatory activity. Such activities can be provided by a single species, such as a naturally occurring cyclic peptide.
Absstract of: US2024108737A1
The present invention relates to multimers of polypeptides which are covalently bound to molecular scaffolds such that two or more peptide loops are subtended between attachment points to the scaffold. The invention also describes the multimerization of polypeptides through various chemical linkers and hinges of various lengths and rigidity using different sites of attachments within polypeptides. In particular, the invention describes multimers of peptides which are high affinity binders of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), particularly the spike protein S1 of SARS-CoV-2. The invention also includes pharmaceutical compositions comprising said polypeptides and to the use of said polypeptides in suppressing or treating a disease or disorder mediated by infection of SARS-CoV-2 or for providing prophylaxis to a subject at risk of infection of SARS-CoV-2.
Absstract of: US2024110160A1
Certain embodiments are directed to a trans-complementation system, system components, and method of using the same for SARS-CoV-2 that can be performed at BSL-2 laboratories for COVID-19 research and countermeasure development. The system thus can be used by researchers in industry, academia, and government laboratories who lack access to BSL-3 facility. This approach also can be applied to other coronaviruses.
Absstract of: US2024110252A1
Kits, devices, systems, and methods are disclosed for the detection of SARS-CoV-2. The kits, devices, systems, and methods utilize two different pairs of polymerase amplification oligonucleotide primers. The first polymerase amplification oligonucleotide primer pair comprises an isolated forward oligonucleotide primer and an isolated reverse oligonucleotide primer for a portion of a SARS-CoV-2 RNA-dependent RNA polymerase (RdRp) or Helicase (Hel) gene sequence. The second polymerase amplification oligonucleotide primer pair comprises an isolated forward oligonucleotide primer and an isolated reverse oligonucleotide primer for a portion of a SARS-CoV-2 Envelope (E) gene sequence. The kits, devices, systems, and methods can specifically detect SARS-CoV-2 infection as well as infection with another Betacoronavirus.
Absstract of: US2024110187A1
Methods are provided for prevention and treatment of 2019 coronavirus (2019-nCoV; COVID-19) infections in mammals by prophylactic or therapeutic administration of pharmaceutical compositions known as STP908. STP908 administered intravenously, whether prophylactically or therapeutically, led to survival of 50 percent of the treatment group infected with 2019-nCoV. STP908 compositions and methods of making them have been previously disclosed, and comprise potent siRNA therapeutics formulated in a histidine-lysine polymeric carrier; the siRNA molecules in STP908 target and reduce or inhibit the expression of two genes of the 2019-nCoV genome: ORF1AB and N-protein, preventing or ameliorating COVID-19 symptoms.
Absstract of: US2024109955A1
Disclosed are antigen binding polypeptides and antigen binding polypeptide complexes (e.g., antibodies and antigen binding fragments thereof) having certain structural and/or functional features. Also disclosed are polynucleotides and vectors encoding such polypeptides and polypeptide complexes; host cells, pharmaceutical compositions and kits containing such polypeptides and polypeptide complexes; and methods of using such polypeptides and polypeptide complexes.
Absstract of: US11944771B1
The invention claims a new type of handheld medical device is meant to help the medical community by enabling them to treat patients remotely. This solves the problem of patient suffering or death due to lack of access to a medical professional or long wait times by enabling a patient-centred response to diseases, such as COVID-19. The device is hand-held, with incorporated germicidal UVC lights, an internal application tip and the delivery mechanism focuses on the mucous membrane. The top chamber connects to a removable container which can be used with the prescribed treatment/therapy, vaccine, or viral testing fluid/reagent, as needed. The versatility, non-invasive nature and germicidal properties constitute distinct improvements over other similar medical devices. This device also promotes the development of non-invasive inoculation and drug delivery systems via the mucous membrane.
Absstract of: AU2022341116A1
Disclosed herein are cross-linked peptides either alone or conjugated to PEG(n)-cholesterol (or thiocholesterol) moieties useful for interfering with and inhibiting or preventing coronavirus infection (e.g., infection by SARS-CoV-2). Also disclosed are methods of treating and/or preventing a coronavirus infection (e.g., COVID-19.
Absstract of: MX2022011892A
The present disclosure is directed to antibodies binding to and neutralizing the coronavirus designated SARS-CoV-2 and methods for use thereof.
Absstract of: MX2022011892A
The present disclosure is directed to antibodies binding to and neutralizing the coronavirus designated SARS-CoV-2 and methods for use thereof.
Absstract of: CA3177500A1
A method for treating patients with COVID-19 and/or other respiratory conditions includes administering eighty-five milligrams of dapsone twice daily for twenty-one days. A variety of dapsone formulations and delivery devices are disclosed, including an inhaler, nasal spray, nasal gel, otic formulation, intravenous formulation, oral solution, oral suspension, patch and suppository.
Absstract of: WO2024061894A1
The present disclosure relates to the use of compounds such as compounds of Formula (I) or a pharmaceutically acceptable salt, solvate and/or prodrug thereof, for example, in pharmaceutical compositions and in the treatment of diseases, disorders or conditions such as diseases, disorders or conditions treatable by inhibiting SWAP-70 and/or treatable by inhibiting neutrophil reactive oxygen species (ROS) production, neutrophil NETosis, B lymphocyte plasmablast development, B lymphocyte IgE production, mast cell degranulation, eosinophil ROS production, mast cell cytokine release, B lymphocyte cytokine release, endothelial cell cytokine release, endothelial cell-immune cell interactions, and/or macrophage/monocyte migration, such as treatment of lung inflammation induced by viruses such as SARS-CoV-2.
Absstract of: LU505188B1
Die vorliegende Erfindung bezieht sich auf das Gebiet der Biotechnologie, insbesondere auf einen neuartigen Teststreifen zum Nachweis von kolloidalem Goldantigen des Coronavirus und dessen Herstellungsverfahren, einschließlich Ab1-Antikörper und Ab2-Antikörper, entsprechend den Ergebnissen des Doppelantikörper-Sandwich-ELISA-Experiments, wobei der monoklonale Ab1-Antikörper als Nachweis-Antikörper auf dem Teststreifen verwendet wird, um das kolloidale Gold zu markieren, der monoklonale Ab2-Antikörper als Nachweislinie auf der Nitrocellulosemembran verwendet wird und der murine Anti-Human-IgG-Antikörper als Qualitätskontrolllinie verwendet wird; Der vorteilhafte Effekt besteht darin, dass der neuartige Teststreifen zum Nachweis von Coronavirus-Antigenen aus kolloidalem Gold und sein Herstellungsverfahren, das in der vorliegenden Erfindung vorgeschlagen wird, das Screening und die gereinigte Expression aus einer menschlichen Phagenbibliothek nutzt, um den monoklonalen Antikörper Ab1 und den monoklonalen Antikörper Ab2 zu erhalten, und dann diese beiden monoklonalen Antikörper verwendet, um Teststreifen herzustellen, die auf dem Prinzip des Doppelantikörper-Sandwiching basieren. Die Leistungsbewertung hat gezeigt, dass die Teststreifen eine gute Sensitivität, Spezifität und Fähigkeit zum Nachweis klinischer Proben aufweisen und als schnelle Hilfe bei der Diagnose von Patienten mit Verdacht auf eine neue Kroneninfektion verwendet werden können sowie eine neue Met
Absstract of: WO2024060356A1
The present invention relates to an economical and feasible method for industrially producing a deuterated COVID-19 medicament key intermediate D. The method has low reaction line cost, and high conversion rate, selectivity, reaction yield, reaction efficiency, and deuterium abundance, and low energy consumption, convenience in post-treatment, and simple reaction operation, and thus is more suitable for industrial production. The intermediate D can be prepared at a high yield, the yield can reach about 95%, the product purity and the deuterium abundance both reach 99% or above, and a medicinal level is achieved.
Absstract of: WO2024059910A1
This disclosure relates to RNA interference (RNAi) reagents for treatment of SARS-CoV-2 infection, compositions comprising same, and use thereof to treat or prevent infection by SARS- CoV-2.
Absstract of: WO2024059891A1
HUNG THANH PHAN COVID-19 NEW SOLUTION is the new Machine for new prevention and new treatment of COVID-19 including all kind of virus causing COVID-19 Pandemic, Flue Pandemic, and small bacteria mix in the air. Many people around the world infected by COVID-19 more than 0.6 billion cases and more than 6.5 million people already died due to COVID-19 and about half million people died per year by Flue, in this new solution I introduce the new machine for new prevention and new treatment of COVID-19 virus or any kind of virus and small bacteria mix in the air. This machine for using at homes,, hospitals, schools, universities, shops, companies at work, age care, child care, crew ships, air planes, suitable for 7,96 billion people around the world to use.
Absstract of: AU2022345251A1
Methods for producing synthetic single-domain monoclonal antibody libraries using humanized llama nanobody framework sequences, libraries obtainable by the method, as well as antibodies selected from the libraries are described. In particular, synthetic single-domain monoclonal antibodies that specifically bind to the spike protein of SARS-CoV-2 and neutralize SARS-CoV-2 infection are described. Use of the disclosed antibodies for the detection, prophylaxis and treatment of SARS-CoV-2 infection is described.
Absstract of: US2024100150A1
Provided here are compositions for a bacterial artificial chromosome-based construct containing a replication-competent recombinant severe acute respiratory syndrome coronavirus-2 genome and methods of making such compositions and uses thereof.
Absstract of: US2024101645A1
The present disclosure is directed to monoclonal antibodies, or antigen-binding fragments thereof, that bind to coronavirus spike proteins, including the spike protein of SARS-CoV-2. These antibodies demonstrate high affinity binding to epitopes on the coronavirus spike protein and/or broad cross-reactivity to the spike protein of various coronaviruses. Compositions comprising the anti-coronavirus antibodies, nucleic acids encoding for the antibodies, recombinant expression vectors, and host cells are also disclosed. The present disclosure is also directed to methods of diagnosing, preventing or treating coronavirus infections, including infections or disease caused by SARS-CoV-2.
Absstract of: US2024101647A1
Agents that bind to sarbecoviruses of multiple clades, neutralizing sarbecovirus infection, in particular neutralizing SARS-CoV-1 and SARS-CoV-2 infection. The agents bind to a unique epitope of the sarbecovirus ACE2-receptor binding domain (RBD) but do not inhibit binding of ACE2 with the RBD. Applications and uses of these agents are further disclosed.
Absstract of: US2024101646A1
The present disclosure relates to antibodies and uses thereof for treating, preventing, and detecting coronavirus infection.
Absstract of: US2024101629A1
The present disclosure relates to methods of treating a disease or disorder associated with a coronavirus infection (e.g., SARS-CoV-19) in a subject, comprising administering an IL-7 protein to the subject. In some aspects, the IL-7 protein is a long-acting IL-7 protein.
Absstract of: US2024101541A1
Bis-amide inhibitors of SARS-CoV-2 (COVID) and methods of using them to treat a severe acute respiratory syndrome.
Absstract of: US2024100208A1
An innovative equipment system comprises a tap water reservoir system, a disinfectant reactor system, a pump system, a disinfection and safety door spraying system, a sewage recycling system and a sewage treatment system, wherein the tap water reservoir system is mainly configured to store tap water in advance according to actual cargo volumes and disinfection requirements, and generally in tons; and the disinfectant reactor system comprises boron-doped diamond electrode modules, a reactor indicating lamp module, a visible reactor, a smart control screen, at least one water tank and a structure protection module. The Innovative disinfection and sterilization equipment system can easily kill bacteria and viruses such as Escherichia coli, Staphylococcus aureus, Salmonella typhimurium, and new coronavirus in a short time and enhance disinfection efficiency. The present invention has no corrosive or irritating effect and is environmental-friendly that would not cause harm to human bodies and would not corrode metal surfaces.
Absstract of: US2024100151A1
The disclosure provides coronavirus mRNA vaccines, including vaccines directed against one or more variant strains of SARS-CoV-2, as well as methods of using the vaccines.
Absstract of: US2024100152A1
Recombinant polynucleotides including a nucleic acid sequence encoding an engineered SARS-CoV-2 spike protein (S12) or an immunogenic fragment thereof, in which the engineered spike protein or immunogenic fragment includes one or more mutations in the S2 segment of the S12 ectodomain. Vaccines, pharmaceutical compositions, and methods of use of the polynucleotides, vaccines, and pharmaceutical compositions in treating, alleviating, or managing SARS-CoV-2 infection and/or one or more symptoms thereof.
Absstract of: US2024100149A1
Described herein is an anti-class II MHC antibody fused to a SARS-CoV-2 antigen. Also described is a vaccine comprising the antibody and methods for treating and/or preventing SARS-CoV-2, wherein the methods comprise administering the antibody to a subject in need thereof. In typical aspects, the vaccine is free of an adjuvant.
Absstract of: US2024100047A1
A nanosystem and methods of treating, including prophylactically, coronavirus infections, such as those caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), by administering such nanosystem to a patient is presented. The nanosystem may be comprised of a single or a combination of therapeutic agents, optionally encapsulated in a nanoparticle having a targeting moiety directed to the particular coronavirus. For CoV-2 infections, at least one therapeutic agent, such as the dual DPP4/ACE2 inhibitor sitagliptin, may optionally be encapsulated within a nanoparticle having a fatty acid such as linoleic acid, as the targeting moiety. Administration can occur intranasally prior to infection for prophylactic treatment or post-infection for treatment of the viral infection.
Absstract of: US2024100031A1
The present disclosure relates to a pharmaceutical composition for preventing or treating viral infections, containing a piperlongumine-based compound as an active ingredient. Specifically, the piperlongumine-based compound according to the present disclosure inhibits SARS-CoV-2 infection, and thus can be useful for treating viral infections, particularly RNA viral infections.
Absstract of: US2024100517A1
The present disclosure provide a detection device of microfluidic polymerase chain reaction (PCR) and a detection system including the same. This all-in-one device and system may be used to detect at least one biological detection chip, so that can amplify gene fragments at the front-end and detect them at the back-end immediately, decreasing the time required for the analysis, enabling real-time, low-cost, and rapid detection of various viruses, such as EBV and COVID-19, without compromising accuracy or sensitivity.
Absstract of: US2024099964A1
A method of prophylactically treating COVID-19 in subject who is at high risk for exposure to SARS-CoV-2 virus or who is been recently exposed to SARS-CoV-2, but who tests negative for the virus, by administering to said subject an effective dose of ivermectin to inhibit one or symptoms of SARS-CoV-2 virus.
Absstract of: US2024102116A1
The present invention is directed towards a process of RT-PCR based diagnosis of SARS-CoV2 and other related respiratory viruses without storing and transporting the naso-pharyngeal and oro-pharyngeal swabs in Viral Testing Media directly after extracting the viral particles from the swabs in a suitable buffer, and using these extracts directly, without involving any steps of RNA isolation/extraction, for RT-PCR based diagnosis of SARS-CoV2. The present invention is also directed towards kits for time and cost-efficient diagnosis of SARS-CoV2 and other related respiratory viruses at efficacies matching or better than the efficacies of the gold-standard RT-PCR method starting from VTM transported swabs for diagnosing the same. The present invention also directs to variant process wherein the viral particles eluted in suitable buffers are further subjected to the conventional steps of RNA extraction before qRT-PCR.
Absstract of: US2024102015A1
COVID-19 is treated with antisense oligonucleotides (ASOs) targeting SARS-CoV-2 viral RNAs or human ACE2 RNA.
Absstract of: WO2024061061A1
Disclosed are a C-type single-domain antibody for neutralizing a novel coronavirus and use thereof. The C-type single-domain antibody of the present invention can inhibit the novel coronavirus (SARS-CoV-2) from invading cells, and is used for the prevention, treatment, and diagnosis of SARS-CoV-2 infection. The C-type single-domain antibody has a wide administration route, and can be administrated by means of nasal drip, nasal spray, spray, atomization inhalation, intramuscular injection, intravenous injection, subcutaneous injection, and the like.
Absstract of: GB2622661A
Composition comprising extracts of Abutilon fruticosum (wancad), Acacia nubica (gumar), Acacia bussei (galool) and Myrsine africana (qorsheen or qurjeen). Antiviral formulation and a viral prophylactic formulation comprising the composition and a method of producing a composition comprising: a) mixing extracts of wancad, gumar, galool and optionally qorsheen, b) adding the extracts to water, c) optionally adding Boswellia frereana (maydi) extract, d) boiling, e) removing the heat, f) filtering and g) sealing the mixture in a container are also included. The composition may comprise maydi extract. The wancad or gumar may be root powder, the galool may be bark powder, the maydi may be resin and the qorsheen may be fruit powder. The composition may be a liquid or tablet. The composition may comprise water. The liquid form may comprise 300-500 g maydi, 4-10 g wancad, 4-10 g gumar, 1-3 g galool, 1-3 g qorsheen and 750-1250 ml of liquid. The tablet may comprise 40-59% galool, 40-59% gumar, 0.5-3% wancad and 0.5-3% qorsheen. The composition may be nasal drops or sprays, mouth sprays or for gargling and may be effective against influenza, respiratory syncytial virus, human metapneumovirus, parainfluenza virus, coronaviruses and rhinoviruses.
Absstract of: EP4342475A1
The present invention relates to a composition for treatment of coronavirus disease 2019 (COVID-19) containing taurodeoxycholic acid (TDCA) or a pharmaceutically acceptable salt thereof as an active ingredient. Specifically, an early full recovery effect has been confirmed through the efficacy of treating clinical symptoms caused by novel severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection, alleviating inflammation, and inhibiting inflammatory cytokines using a pharmaceutically acceptable salt of taurodeoxycholic acid, and thus the taurodeoxycholic acid or a pharmaceutically acceptable salt thereof can be used as an active ingredient in a composition for prevention or treatment of lower respiratory tract infectious diseases, including coronavirus disease 2019.
Absstract of: GB2622559A
A protein complex comprising a carrier protein and phosphorylcholine (PCHO/CHOP/PC/C5H14NO4P) for treating and/or preventing a virus infection. The carrier protein may be a virus protein or a bacterial protein. The protein complex may induce or increase the amount of anti-phosphorylcholine antibodies in the individual. The viral infection may be a viral infection, such as influenza, adenovirus, respiratory syncytial virus (RSV), rhinovirus, or coronavirus, e.g. SARS-CoV-1 or SARS-CoV-2. The phosphorylcholine protein complex may bind to the viral surface proteins of the virus. Binding of the phosphorylcholine to the virus protein may permit virus entry into a target cell. Also claimed is a separate invention relating to an anti-phosphorylcholine antibody which binds to a complex comprising a virus protein and phosphorylcholine for use in treating and/or preventing a virus infection in an individual. A further embodiment is a method and use for predicting the prognosis of a virus infection by determining the amount of anti-phosphorylcholine antibodies in a sample from a subject. A further embodiment is a method for identifying an individual in need of anti-viral therapy by predicting the prognosis of the infection. The antibodies may elicit an immune response to clear the virus upon binding to the complex.
Absstract of: US11939354B1
Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.
Absstract of: CN117766054A
The invention discloses a method and a system for generating a compound intervention scheme based on a pre-training model and application of the method and the system, compounds refer to nutritional supplements, traditional Chinese medicines, natural products with medicinal values capable of being explored or new compounds of old medicines, and particularly refer to a method and a system for generating a personalized nutritional supplement combination intervention scheme. The method of the invention can be used to successfully quantitatively characterize the effect of the compound, and the method of the invention can also be used to guide the medication of patients, or clinical nutritional regimens, for example, patients infected with novel coronavirus.
Absstract of: CN117757985A
Sequences for the detection of SARS-CoV-2 are provided and include, for example, SEQ ID NO: 4-8. These sequences can be used to amplify the SARS-CoV-2nsp8 gene in a sample using reverse transcription loop-mediated isothermal amplification (RT-LAMP), and are preferably used in combination with a Cas enzyme/sgRNA pair and a reporter nucleic acid. The disclosed sequences can be used in a method for detecting the SARS-CoV-2 nucleic acid in a sample. In general, a specific gene sequence of the SARS-CoV-2RNA (herein, nsp8) is amplified using RT-LAMP (Reverse Transcription Loop-Mediated Isothermal Amplification). The RT-LAMP product is scanned by a Cas12a-gRNA (guide ribonucleic acid) ribonucleoprotein (RNP) compound. RNP is combined with a specific complement of gRNA, and the transcleavage activity of Cas12a is activated. The active Cas12a system cleaves a short ssDNA reporter, which is preferably labeled, with a fluorophore and a quencher at both ends. The cleavage of the reporter separates the quencher from the fluorophore and generates fluorescence detectable by the naked eye.
Absstract of: CN117769541A
The present invention provides, inter alia, compounds, pharmaceutical compositions and methods related to the treatment of viral infections caused by coronavirus or enterovirus. The present invention provides compounds # imgabs0 # of formulae (I), (II) and (III) and methods of using the compounds for therapy. These compounds are peptidic mimetics that inhibit the protease 3CL of coronavirus and are useful in the treatment of conditions caused by viral infections, including COVID-19.
Absstract of: CN117737191A
The invention discloses an in-vitro activity fluorescence screening method for detecting SARS-CoV-2nsp13, and designs an optimal fluorescence method by utilizing a principle that a QuantiFluor dsDNA dye is used for dyeing dsDNA to generate a fluorescence signal, and the optimal fluorescence method is used for in-vitro activity detection of SARS-CoV-2 virus protein and can be used for discovering a specific antiviral drug of RNA virus by targeting nsp13 helicase; the method comprises the following steps: S1, annealing a short-chain DNA and a quenching chain in a ratio of 1: 1.1 to prepare a helicase dsDNA substrate; and S2, diluting the nsp13 helicase protein by using an HTS assay buffer, adding a helicase dsDNA substrate into a tube for reaction, after double strands are unwound by the nsp13 helicase, then adding a QuantiFluor dsDNA dye mixture, detecting the fluorescence intensity of the mixture, and screening the small-molecule inhibitor of the SARS-CoV-2nsp13 helicase by judging the intensity of a fluorescence signal. The method can be applied to screening of the SARS-CoV-2nsp13 helicase small-molecule inhibitor, has the characteristics of miniaturization, automation, rapidness, reliability and the like, is suitable for high-throughput application, and can also be applied to development and development of a novel SARS-CoV-2nsp13 helicase activity detection kit.
Absstract of: CN117736314A
The present invention relates to highly efficient neutralizing antibodies and antigen-binding fragments thereof directed against SARS-CoV-2 and variants thereof, and methods of making and using the neutralizing antibodies and antigen-binding fragments thereof. The separated antibody or the antigen binding fragment of the separated antibody is specifically combined with S protein of SARS-CoV-2 and can efficiently neutralize the SARS-CoV-2 and variants of the SARS-CoV-2, the variants include but not limited to Alpha (B.1. 1.7), Beta (B.1.351), Gamma (P.1), Delta (B.1.617.2) and Omicron variants, and the Omicron variants include but not limited to B.1. 529, BA.1, BA.2, BA.2. 12.1, BA.3, BA.4 and BA.5. The invention further discloses a preparation method of the antibody or the antigen binding fragment of the separated antibody or the antigen binding fragment of the separated antibody.
Absstract of: CN117731666A
The invention discloses application of lycorine oxygen ester and salt thereof in preparation of broad-spectrum anti-coronavirus drugs, the lycorine oxygen ester and the salt thereof are applied to anti-coronavirus, cytopathic effect (CPE) caused by GD108 strain of SARS-CoV-2 can be remarkably inhibited, and the drug effect is better than that of a positive drug, namely, redecevir; and meanwhile, the strain has a very good inhibition effect on four variants of the coronavirus, namely an Alpha strain, a Beta strain, a Delta strain and an Omicron strain. In-vivo anti-virus experiments on golden hamsters show that lycorine oxygen ester also has a remarkable anti-virus effect on contaminated animals, lays a foundation for further development of anti-coronavirus drugs, and has important development value and wide application prospects. The raw materials of the medicine are low in toxicity and high in safety; the compound is rich in source, is applied to preparation of anti-coronavirus drugs and reduction of coronavirus infection, and is of great significance to prevention and treatment of coronavirus.
Absstract of: CN117737300A
The invention relates to the technical field of molecular biology, and particularly provides a method for detecting H1N1, MERS and new coronavirus pathogens causing respiratory diseases based on a microfluidic technology. According to the present invention, the actual requirements of H1N1, MERS and new coronavirus detection are combined, the micro-fluidic chip is researched and developed, the method has characteristics of strong sensitivity and high specificity, the used reagent consumables can be stored at the normal temperature, the transportation and the carrying are convenient, and the method is especially suitable for the rapid field detection of pathogens.
Absstract of: CN117741151A
The invention discloses a method for determining the biological activity of an Fc segment of cat IgG, and belongs to the technical field of biological activity detection of animal immune globulin products. The preparation method comprises the following steps: by taking feline coronavirus as an antigen and sheep red blood cells as sensitization red blood cells, connecting tanned red blood cells with chromium chloride, sensitizing the red blood cells by using the feline coronavirus, exposing a binding site of a complement C1q of an Fc segment of feline IgG through a specific reaction of an antigen and an antibody, and activating a complement reaction after adding the complement, so that an erythrocyte membrane is broken and hemolysis is caused; the method is characterized in that a cat IgG (immunoglobulin G) is taken as a template, the Fc segment activated complement function index of the cat IgG is calculated through a hemolytic reaction kinetic curve, the Fc segment activated complement function index of the cat IgG is greater than or equal to 70.0% and is higher than the standard that the intravenous injection human immune globulin (pH 4) is greater than or equal to 60.0%, and methodology proves that the established method is good in repeatability and has operability.
Absstract of: CN117736313A
The invention belongs to the technical field of monoclonal antibodies, and particularly discloses a novel coronavirus RBD specific monoclonal antibody and application of the novel coronavirus RBD specific monoclonal antibody. The invention has important scientific significance and application prospects for prevention and clinical treatment of diseases caused by the novel coronavirus SARS-CoV-2 and research and development of diagnostic reagents.
Absstract of: CN117750972A
The present disclosure provides combination mRNA vaccines against respiratory viruses, such as influenza and coronavirus (e.g., SARS-CoV-2), and methods of using the vaccines.
Absstract of: CN117736315A
The invention provides a monoclonal antibody for resisting novel coronavirus NP protein as well as application and a product of the monoclonal antibody, and relates to the technical field of biology. The monoclonal antibody for resisting the novel coronavirus NP protein, provided by the invention, has good specific binding capacity to the novel coronavirus NP protein and a mutant strain NP protein, is superior to the existing antibody for resisting the novel coronavirus NP protein, and can be used for detecting the novel coronavirus NP protein.
Absstract of: CN117751105A
The present disclosure provides a compound of formula (II): # imgabs0 # wherein R1 is a monocyclic or bicyclic saturated, partially unsaturated or aromatic heterocyclic group, optionally substituted, comprising at least one nitrogen atom, and the other variables are as defined herein. The compounds are inhibitors of the coronavirus major protease (MPRO). Also disclosed are methods for preparing the compounds, as well as the use of the compounds, for example, in the treatment and/or prevention of coronavirus diseases such as COVID-19.
Absstract of: CN117751137A
The present disclosure provides antibodies and antigen-binding fragments thereof that can bind to SARS-CoV-2 antigens, and in certain embodiments can neutralize SARS-CoV-2 infection. Also provided are polynucleotides encoding the antibodies or antigen binding fragments, vectors and host cells comprising the polynucleotides, pharmaceutical compositions, and methods of treating or diagnosing SARS-CoV-2 infection using the antibodies, antigen binding fragments, polynucleotides, vectors, host cells, and compositions disclosed herein.
Absstract of: CN117750974A
The present disclosure relates to the field of prevention or treatment of viral infections. In particular, the disclosure relates to agents for vaccinating against viral infections and inducing potent viral antigen-specific immune responses, such as antibody and/or T cell responses, and methods for producing and using these agents. Administration of an agent, such as RNA, disclosed herein to a subject can protect the subject from viral infection. In particular, the disclosure relates to amino acid sequences comprising at least a portion of a viral protein having amino acid modifications found in other variants of the viral protein. Administration of RNA encoding one or more amino acid sequences may provide protection against a variety of viral variants. In particular, the methods and agents described herein can be used to prevent or treat coronavirus infections, such as SARS-CoV-2 infections.
Absstract of: WO2024058192A1
Provided is a novel antibody which may be used for the treatment of SARS-CoV-2. An antibody or an antigen-binding fragment thereof according to the present disclosure is an anti-CADM1 antibody or an antigen-binding fragment thereof, wherein the antibody is selected from the group consisting of (Ca) and (Cb): (Ca) an antibody comprising the amino acid sequences of a heavy chain CDR1, a heavy chain CDR2, and a heavy chain CDR3 represented by SEQ ID NOs:1, 2 and 3, respectively, and a light chain CDR1, a light chain CDR2 and a light chain CDR3 represented by SEQ ID NOs:4, 5 and 6, respectively; and (Cb) a variant of (a) antibody including some of substitution, insertion, addition, or deletion in the heavy chain CDR1, the heavy chain CDR2, the heavy chain CDR3, the light chain CDR1, the light chain CDR2 and/or the light chain CDR3.
Absstract of: US2024093234A1
The present disclosure provides expression vectors, e.g., chimeric adenoviral vectors, comprising a nucleic acid encoding a coronavirus disease 2019 (COVID-19) N protein, e.g., an N protein from SARS-CoV-2, and a heterologous antigenic polypeptide and methods employing such expression vectors for using the vectors to elicit an immune response.
Absstract of: WO2024055843A1
A method for detecting novel coronavirus on the basis of receptor binding. The method comprises: using cross-linked agarose as a matrix, and performing surface modification with carboxyl on same to then obtain magnetic agarose microspheres; binding the magnetic agarose microspheres to a receptor protein by means of covalent coupling to form receptor-protein-coupled magnetic agarose microspheres, wherein the receptor protein covalently bound to the surfaces of the magnetic agarose microspheres recognizes the receptor binding region of the outer-membrane S protein in a novel coronavirus sample, allowing the two to bind to each other to simulate the binding process of novel coronavirus and a host cell so as to capture novel coronavirus; sequentially cleaning, purifying and eluting the magnetic microspheres to obtain novel coronavirus having the ability of binding to cells; and detecting and evaluating the infection activity and transmissibility thereof by means of combined immunobinding-fluorescence quantitative PCR. The method is suitable for evaluating viral replication and transmission during the treatment of a person infected with novel coronavirus, and the infectivity of novel coronavirus in a cured patient when he/she experiences novel coronavirus rebound.
Absstract of: WO2024059842A2
Pharmaceutical formulations for nasal administration are disclosed. The pharmaceutical formulation contains a green tea catechin derivative (such as an epigallocatechin-3-gallate-palmitate); and preferably further includes a carbohydrate (such as a polysaccharide); and a pharmaceutically acceptable carrier. The pharmaceutical formulation has a viscosity sufficient to maintain the green tea catechin derivative in contact with nasal epithelial cells optionally for at least about 30 minutes in the presence of mucus. Also described are methods of using the nasal formulations for preventing, reducing, and/or treating neurological damages caused by exposure to a virus, such as a SARS-CoV-2. For example, the disclosed pharmaceutical formulations can treat or prevent one or more symptoms of long COVID in an infected subject, and/or repair the damaged nasal epithelial cells, neuroepithelial cells, vascular cells, and/or neurons and restore their functions in a subject recovered from a COVID infection, such as the olfactory function of these cells.
Absstract of: WO2024059247A2
The present disclosure relates to methods of treating Alzheimer's disease, diseases and/or conditions associated with Covid-19 infection, including long COVID, a post-acute infection syndrome, or symptoms of orthostatic intolerance comprising administration of a therapeutically-effective combination of a COX-2 inhibitor and an antiviral compound.
Absstract of: WO2024059149A2
Provided are fusion proteins including an amino acid sequence of an ectodomain of Spike protein of a coronavirus, such as SARS-CoV-2, joined to an amino acid sequence of a ferritin subunit polypeptide. Nanoparticles including such fusion proteins, with surface-exposed trimers of the ectodomain of the Spike protein of the coronavirus, are also provided. Also provided are nucleic acids and vectors encoding the fusion proteins, cells containing such nucleic acid and vectors, immunogenic compositions including the fusion proteins, the nanoparticles, or the vectors, as well as corresponding methods and kits.
Absstract of: WO2024058760A2
A prediction system for predicting the severity of the course of the disease when individuals are infected with COVID-19 disease, comprising a processor unit, an input unit for inputting data to said processor unit, an output unit for outputting data to said processor unit and a memory unit associated with the processor unit for reading/writing data. The processor unit is configured to access a mathematical model in said memory unit which, when taking as input the parameter values of age, number of comorbidities, blood group, tAB1 and/or ligands and tAA and/or ligands, classifies the disease into one of at least two disease course categories; to receive the parameter values of age, number of comorbidities, blood group, tAB1 and/or ligands and tAA and/or ligands as input from an input unit, and to output the classification result produced by the said mathematical model in response to the parameter values of age, number of comorbidities, blood group, tAB1 and/or ligands and tAA and/or ligands as output from an output unit.
Absstract of: WO2024055429A1
Disclosed in the present invention are an SARS-COV-2 antigen polypeptide, a recombinant adeno-associated virus and the use thereof. The present invention uses an S protein or RBD of the SARS-COV-2 antigen polypeptide as an antigen. A truncated domain has a shorter sequence length, a smaller molecular weight and a clearer structure, and has specificity. The recombinant adeno-associated virus, which contains a nucleic acid sequence encoding the antigen polypeptide achieves gene delivery via intramuscular injection and can effectively and continuously express the antigen polypeptide. The antigen polypeptide, which is expressed by the recombinant adeno-associated virus of the present invention in vivo, can induce a specific immune response against the SARS-COV-2 antigen polypeptide, and an antibody serum produced thereby can not only specifically recognize the SARS-COV-2 RBD antigen polypeptide, but also has a neutralizing titer, and can inhibit the replication and transmission of variant strains Delta and Omicron or prevent the variant strains Delta and Omicron from settling in a host, thereby effectively preventing and/or treating COVID-19 caused by SARS-CoV-2.
Absstract of: WO2024059671A2
Provided are methods and systems for measuring lung function, such as shunt and deadspace, using pulmonary gas exchange in management and treatment of pulmonary diseases including COVID-19.
Absstract of: US2024091167A1
Provided is the use of two-dimensional nanomaterials in the inhibition of a coronavirus, and specifically disclosed is the use of the two-dimensional nanomaterials in the preparation of a medicament for treating or preventing diseases caused by a coronavirus or of a material for adhering to or inhibiting the coronavirus. The two-dimensional nanomaterial is selected from the group consisting of copper indium thiophosphate (CIPS) nanosheet, graphene oxide nanosheet, molybdenum disulfide nanosheet, black phosphorus nanosheet and mixtures thereof. The coronavirus is selected from one of HCoV-229E, HCoV-OC43, HCoV-NL63, HCoV-HKU1, SARS-CoV, SARS-CoV2 or MERS-CoV. The diseases caused by the coronavirus are diseases caused by coronavirus infection. The material has the advantages of being simple to prepare, having a high biological safety and an excellent effect.
Absstract of: AU2022346926A1
A molecularly imprinted polymer comprises at least one recognition site that is complementary to a template molecule consisting of an amino acid sequence corresponding to a subsequence of the receptor binding domain of SARS-CoV-2 spike protein, wherein the amino acid sequence is no more than 50 amino acids in length and comprises a sequence selected from (i) NSNNLDSKVGG, (ii) NYNYLYRLFRKS, (iii) YRLFRKSNLKPF, (iv) STEIYQAGSTPC, (v) CNGVEGFNCYF,(vi) GSTPCNGVEGF, (vii) CYFPLQSYGFQP, (viii) GFQPTNGVGYQ and (ix) LQSYGFQPTNG. A method of preparing the molecularly imprinted polymer is also provided. Conjugates comprising the molecularly imprinted polymer and a fluorophore are also provided as are compositions containing the molecularly imprinted polymer and conjugates of the invention. The molecularly imprinted polymer, conjugate and compositions can be used in the detection of SARS-CoV-2.
Absstract of: AU2022341116A1
Disclosed herein are cross-linked peptides either alone or conjugated to PEG(n)-cholesterol (or thiocholesterol) moieties useful for interfering with and inhibiting or preventing coronavirus infection (e.g., infection by SARS-CoV-2). Also disclosed are methods of treating and/or preventing a coronavirus infection (e.g., COVID-19.
Absstract of: AU2022322270A1
Disclosed herein are nucleic acid constructs for producing a virus-like particle (VLP) capable of raising an immune response against severe acute respiratory syndrome coronavirus (SARS-CoV), and uses thereof, wherein the constructs comprise nucleic acid sequences encoding an immunogen and a polyprotein, wherein the polyprotein comprises two or more viral structural proteins, wherein at least two of the two or more viral structural proteins are separated by a signal peptidase sequence such that, when the polyprotein is expressed in a host cell, the signal peptidase sequence undergoes host cell peptidase-dependent cleavage to liberate the two or more viral structural proteins, thereby allowing the liberated structural proteins to self-assemble into a VLP carrying the immunogen.
Absstract of: US2024092875A1
The present disclosure provides antibodies and antigen-binding fragments thereof that specifically bind to the spike protein of SARS-CoV-2 and methods of using such antibodies and antigen-binding fragments thereof for the prevention and treatment of Coronavirus Disease 2019 (COVID-19) in a subject.
Absstract of: US2024092834A1
In certain aspects, provided herein are methods of inhibiting neutrophil degranulation in a patient infected with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) by administering a composition comprising (a) a TAT-fusion protein comprising an 11 amino acid cell penetrating peptide TAT operably linked to an N-terminal SNARE domain of SNAP-23 (TAT-SNAP-23), and/or a TAT-fusion protein comprising an 11 amino acid cell penetrating peptide TAT operably linked to a SNARE domain of syn-taxin-4 (TAT-STX-4), wherein the inhibition is compared to a control.
Absstract of: US2024092759A1
Provided herein are compounds of formula (I) or (I-A), which act as non-covalent inhibitors of SARS-CoV2 main protease (Mpro). The compounds of formula (I) or (I-A) are useful in treating COVID-19 infections, as well as reducing or ameliorating symptoms associated with COVID-19 infection.
Absstract of: US2024091341A1
The present invention provides a new component that is useful as a SARS-CoV-2 vaccine antigen that uses as a target a receptor binding domain of SARS-CoV-2. The present invention contains the fusion protein, which includes hemagglutinin and a receptor binding domain of SARS-CoV-2, and a vaccine containing the fusion protein.
Absstract of: US2024091298A1
The present invention provides a process for preparing a pharmaceutical preparation which is to be used for treatment of the viral infections, specifically the infections caused by related RNA virus such as Coronavirus (COVID-19) disease. The present invention also provides the method of treating viral infections or the infections caused by related RNA viruses such as COVID-19 disease using Hordeum or Barley or Barley extracts or the pharmaceutical preparation comprising them and the combinations thereof. The present process is simple, economical, bio friendly, and industrially applicable.
Absstract of: US2024091246A1
A method of treatment for coronavirus disease 2019 (COVID-19) is disclosed herein. The method comprises administering a therapeutically effective dose of a combination of ribavirin and minocycline. A pharmaceutical composition comprising ribavirin and minocycline is also disclosed herein. The pharmaceutical composition may further include one or more pharmaceutical excipients.
Absstract of: US2024091253A1
Method and composition for treating or preventing a respiratory illness. The method includes administering at least one dose of a pharmaceutically acceptable fluid having a pH less than 3.0 into contact with at least one region of the respiratory tract present in a patient in need thereof. Respiratory illness that can be treated include COVID-19.
Absstract of: US2024091243A1
The present disclosure relates to compounds and methods for preventing infection, symptoms, or sequelae resulting from viral infection, including influenza infection, rhinovirus infection, or betacoronavirus infection, such as human coronaviruses such as SARS coronaviruses, MERS coronaviruses, and COVID-19, including Acute Respiratory Distress Syndrome (ARDS) associated with the viral infection.
Absstract of: US2024091178A1
A method for treating patients with COVID-19 and/or other respiratory conditions includes administering eighty-five milligrams of dapsone twice daily for twenty-one days. A variety of dapsone formulations and delivery devices are disclosed, including an inhaler, nasal spray, nasal gel, otic formulation, intravenous formulation, oral solution, oral suspension, patch and suppository.
Absstract of: US2024091483A1
Provided herein are devices and methods that relate to ventilation and respiration. In one embodiment, a ventilator device comprising a fluidic amplifier with one or more coaxially aligned components, where there are no internal moving components. In another embodiment, a device and related methods for treating a patient who needs ventilation such as after infection by the coronavirus Covid-19.
Absstract of: US2024091368A1
The present invention relates to multimers of polypeptides which are covalently bound to molecular scaffolds such that two or more peptide loops are subtended between attachment points to the scaffold. The invention also describes the multimerization of polypeptides through various chemical linkers and hinges of various lengths and rigidity using different sites of attachments within polypeptides. In particular, the invention describes multimers of peptides which are high affinity binders of ACE2. The invention also includes pharmaceutical compositions comprising said polypeptides and to the use of said polypeptides in suppressing or treating a disease or disorder mediated by ACE2, such as infection of COVID-19 or for providing prophylaxis to a subject at risk of infection of COVID-19.
Absstract of: US2024091344A1
The present invention relates to mRNAs suitable for use as mRNA-based vaccines against infections with MERS coronaviruses. Additionally, the present invention relates to a composition comprising the mRNAs and the use of the mRNAs or the composition for the preparation of a pharmaceutical composition, especially a vaccine, e.g. for use in the prophylaxis or treatment of MERS coronavirus infections. The present invention further describes a method of treatment or prophylaxis of infections with MERS coronavirus using the mRNA sequences.
Absstract of: US2024094217A1
The present disclosure, in part, relates to novel, relates to novel, prognostic tools for severe COVID-19 disease, including identification of a set of clinical parameters that can be used to generate a clinical risk score of COVID-19 complications. The present disclosure also relates to proteomic panel-profiling of patients with severe COVID-19 complications versus mild-moderate symptoms to characterize biological processes and pathways associated with disease severity. Also disclosed are identified molecular changes associated with the clinical findings that can be used to generate a molecular severity score. In addition, the methods disclosed here relate to identifying effective methods of treatments based on the patient analysis.
Absstract of: US2024093318A1
Provided by the inventive concept is a DNA methylation-based platform, and machine learning algorithms, for diagnosing respiratory pathogens including SARS-CoV-2 and predicting COVID-19 related outcomes, and methods of using the same, such as in identifying the presence of a viral infection, such as a SARS-CoV-2 infection, determining whether a subject has COVID-19, and/or whether a subject with COVID-19 is likely to develop acute respiratory distress syndrome or multisystem inflammatory syndrome in children.
Absstract of: US2024093286A1
This invention relates to a novel composition of RNA/mRNA medicines and/or vaccines produced by using Replicase/RNA-dependent RNA polymerase (RdRP)-mediated RNA Cycling Reaction (RCR). This RCR-amplifiable RNA/mRNA composition comprises at least a replicase/RdRP-binding site (RdRP-BS) in the 5′-end or 3′-end, or both, of a desired RNA sequence of interest, to form a self-amplifying RNA/mRNA (samRNA) platform. The samRNA platform so obtained is useful for designing and developing a variety of self-amplifying RNA/mRNA (samRNA) constructs, of which the desired RNA sequences may include, but not limited to, antisense oligonucleotide RNA (aRNA; ASO), small interfering RNA (siRNA), short hairpin RNA (shRNA), microRNA (miRNA)/miRNA precursor (pre-miRNA), long non-coding RNA (lncRNA), and/or messenger RNA (mRNA), or a combination thereof. The present RdRP-BS designs in said samRNA are derived or modified from the identified RdRP-BS motifs of coronavirus (e.g. SARS-CoV-2-associated viruses) and/or hepatitis C virus (HCV) in either single-stranded or double-stranded conformation, or a combination thereof.
Absstract of: WO2024056106A1
Provided are a vesicular stomatitis virus vector, which comprises sgVSV (△L/L) and sgVSV (△G/G), which can load and express an exogenous gene, is lower in toxicity relative to a wild type strain, has a smaller likelihood of recombinant mutation relative to an existing srcVSV vector, has a larger exogenous gene loading capacity, and can be used for vaccine development, gene delivery drugs, and treating tumors. Further provided is a vesicular stomatitis virus sgVSV (ΔG/GδRBD) carrying a novel coronavirus RBD gene.
Absstract of: CA3218520A1
The invention relates to novel compounds of formulae (I) and (II), to the use thereof as a drug, particularly for the treatment of SARS-CoV-2, for the treatment of COVID-19 disease and any diseases related to beta-coronaviruses, and for the in vitro application thereof in order to study the interaction with Mpro protease. The invention also relates to pharmaceutical compositions comprising, as an active principle, at least one compound of formulae (I) or (II).
Absstract of: CA3219586A1
The present invention relates to a mutated SARS-CoV-2 spike protein, a variant or fragment thereof or an mRNA or DNA encoding them for use in the prevention of COVID-19.
Absstract of: CN117440812A
The present invention relates to a pharmaceutical composition for use in the treatment of acute respiratory distress syndrome, multi-terminal organ failure and survival in the event of severe life-threatening in a patient with coronavirus disease 2019 (COVID-19), the pharmaceutical composition comprising (a) Sensaquinine; (b) an antiviral therapy for SARS-CoV-2 infection (including ridecevir, ivermectin, chloroquine, hydroxychloroquine, azithromycin, tenofovir, emtricitabine, ritonavir, lopinavir, ASC09, favipiravir, danoprovir, an angiotensin converting enzyme inhibitor (ACEI), an angiotensin receptor blocker (ARB), recombinant human angiotensin converting enzyme 2 (rhACE2), Xiyanping, alpha-interferon, influenza enzyme (DAS181); an immunomodulatory and cell-targeted therapy system (e.g., EPA-FFA), nitric oxide, PUL-042, Pam2CSK4 acetate, a TLR2 agonist, a TLR6 agonist, and a TLR9 agonist), convalescent plasma, stem cells or exosomes thereof, immunomodulatory and cell-targeted therapy (e.g., ENT-FFA), toltrazumab, Slulimab, Acateninib, Pirelidipine, tradipitant, CD24Fc, Emulumab, Analastin, TJ003234, BLD-2660, blood purification system, EPA-FFA, PAL-042, Pam2CSK4 acetate, TLR2 agonist, TLR6 The preparation method comprises the following steps of: preparing an oxygen concentrator, an oxygen generator, T89, a compound salvia miltiorrhiza dropping pill, a plasminogen supplement, a plasminogen activator and arteplase; (c) budesonide, a fever reduction support therapy (e.g., acet
Absstract of: WO2022240746A1
Provided herein are method for treating or preventing severe coronavirus disease 2019 (COVID-19) in a subject, comprising administering to the subject a composition comprising a modulating agent that decreases or increases the expression or gene product activity of one or more driver genes.
Absstract of: EP4338736A1
This agent for treating coronavirus infectious diseases caused by mutant viruses of SARS-CoV-2 contains, as an active ingredient, 6-fluoro-3-hydroxy-2-pyrazinecarboxamide or a salt thereof.
Nº publicación: EP4337689A1 20/03/2024
Applicant:
APPLIED BIOMEDICAL SCIENCE INST [US]
UNIV KANSAS STATE [US]
Applied Biomedical Science Institute,
Kansas State University Research Foundation
Absstract of: WO2022241057A1
Provided herein are binding polypeptides, such as binding peptides and antibodies, against a SARS CoV-2. The binding polypeptides relate to or are based on bovine antibodies, particularly those containing an ultralong CDR3. Also provided herein are methods of treating a virus infection, such as a coronavirus infection, by delivering to a subject in need a provided binding polypeptide.