If you want to distinguish your goods, services or both from those of another company, you may need a trademark or trade name. Find out what they are, what their registration procedure is and what it involves.
Information on the deadlines for filing applications for transformation of European Union trademarks into Spanish national trademarks. See more
If you have a new device, product or procedure that solves a technical problem or has a practical advantage, there are different ways to protect it in Spain and other countries. Find out how.
Does your innovation lie in the aesthetics, ornamentation or appearance of your product? Protect it through industrial design. Find out what rights registration confers and how to proceed.
Patents published worldwide are a valuable source of scientific, technical and commercial information.
El Bono 3 del Fondo para PYMEs 2025, que cubre la elaboración de Informes Tecnológicos de Patentes (ITP) y Búsquedas Retrospectivas se cerrará el lunes 10 de febrero de 2025 al cierre de la jornada laboral. Próximamente se informará sobre su reapertura. Puede consultar más información aquí.
If you are an entrepreneur or a company and you want to boost and improve the profitability of your business by adequately protecting the intangible assets of your organisation, in this space you will find what you need.
29
results.
Updated on
12/07/2025 [07:45:00]
Absstract of: US2025186477A1
The present disclosure provides compositions (e.g., injectable compositions) comprising fludarabine (e.g., fludarabine phosphate), and methods of using same to treat cancers, such as a lymphoma, and/or to lymphodeplete a subject in need thereof, for example in association with a CAR-T therapeutic regimen.
Absstract of: US2025186451A1
The present disclosure relates generally to use of a compound of formula (I), also named ASTX660 in combination therapies for treating cancer, in particular leukemia.
Absstract of: US2025186492A1
The present invention provides a CAR-T cell targeting B7-H3 and an application thereof in the treatment of acute myeloid leukemia (AML). Specifically, the present invention provides a CAR-T cell targeting B7-H3, which comprises an scFv which targets B7-H3, a 41BB costimulatory signaling molecule and a CD3ζ domain. The B7-H3-CAR-T cell of the present invention has significant specific killing toward B7-H3 positive AML tumor cells. The results of animal experiments show that the B7-H3-CAR-T cell can significantly inhibit the growth of AML tumor cells in mice, significantly prolong the survival period of mice, and has a significant anti-tumor effect in vivo. The B7-H3-CAR-T cell of the present invention can be used as a novel therapeutic method for the targeted treatment of AML, and has huge clinical application prospects.
Absstract of: US2025188545A1
Provided herein are methods of predicting the responsiveness of a lymphoma patient to a cancer treatment comprising clustering patients into subgroups of patients using gene expression levels. Also provided herein are methods of treating a lymphoma patient based on predicting the responsiveness of the lymphoma patient to a cancer treatment.
Absstract of: AU2023373683A1
Methods of treating non-Hodgkin lymphoma by administering a multispecific antibody to a patient in need are provided. Methods of making such antibodies, and compositions, including pharmaceutical compositions, comprising such antibodies, are also provided.
Absstract of: AU2023373360A1
A method for assessing responsiveness of a subject to a treatment comprising T cells expressing a bivalent BCMA-targeting chimeric antigen receptor (CAR), comprising administering to the subject the T cells, and assessing the responsiveness of the subject to the treatment based on time length the subject maintains minimal residual disease (MRD) negative status.
Absstract of: WO2025120218A1
The invention provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; wherein the CD16a-binding motif sequence is: QQIAQYEIRRLPNLNHHQTFAFIKSLL (SEQ ID NO: 1). The invention also provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; wherein the sequence of the CD16a-binding polypeptide is: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2). The invention also provides a CD16a-binding polypeptide which comprises the following structure: BCMA-binding polypeptide-Linker 1-BCMA-binding polypeptide-Linker 2-CD16a-binding polypeptide, wherein: each of the BCMA-binding polypeptides comprises the sequence: VDNKFNKENQFADEEIAALPNLNFYQKWAFIRKLMDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 4); the CD16a-binding polypeptide comprises the sequence: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2) or comprises the sequence: VDNKFNKEQQIAQYEIRKLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 3); and wherein each of Linker 1 an
Absstract of: WO2025122791A1
Provided herein are methods and uses for treating multiple myeloma (such as Newly Diagnosed Multiple Myeloma) in a patient in need thereof. The methods comprise administering to the patient an anti-CD38 antibody, bortezomib, lenalidomide, and dexamethasone.
Absstract of: WO2025120219A2
The invention provides a CD16a-binding polypeptide, which comprises at least one motif that binds to CD16a, wherein said polypeptide comprises the following structure: N-terminal portion-Helix 1-Separating portion-Helix 2-C-terminal portion, the CD16a-binding motif being the portion Helix 1-Separating portion-Helix 2; the CD16a-binding polypeptide further comprising at least one additional functional portion, wherein the at least one functional portion comprises an additional binding moiety which is a binding partner recognising a protein in the B7 family and which is a polypeptide, peptide or small molecule. The invention also provides pharmaceutical compositions comprising the CD16a- binding polypeptide, and the use of the CD16a-binding polypeptide or pharmaceutical compositions as a medicament, particularly for use in the treatment or prophylaxis of cancer, such as multiple myeloma.
Absstract of: WO2025122985A1
Provided herein are methods of treating acute myeloid leukemia (AML) in a subject in need thereof, comprising administering to the subject combinations of Compound 1, or a pharmaceutically acceptable salt thereof, venetoclax, and 5-azacitidine. Also provided herein are methods of inhibiting/overcoming resistance of AML to venetoclax in a subject in need thereof, and/or improving the efficacy of venetoclax in the treatment of AML in a subject in need thereof, comprising administering to the subject combinations of Compound 1, or a pharmaceutically acceptable salt thereof, venetoclax, and 5-azacitidine.
Nº publicación: WO2025119248A1 12/06/2025
Applicant:
DU XINYUN [US]
HUANG QIANG [CN]
\u675C\u5FC3\u8D5F,
\u9EC4\u5F3A
Absstract of: WO2025119248A1
A compound represented by formula (I) as a PCNA inhibitor, or a pharmaceutically acceptable salt thereof, or a deuterated compound thereof, a preparation method therefor, an intermediate compound thereof, a pharmaceutical composition thereof and the use thereof. The PCNA inhibitor and the pharmaceutical composition comprising same can be used for treating cancers, comprising lung cancer, melanoma, colon cancer, rectal cancer, prostate cancer, ovarian cancer, leukemia, etc with PCNA overexpression.
BOPI
Electronic site
